PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s679071g007
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family MIKC_MADS
Protein Properties Length: 184aa    MW: 21024.5 Da    PI: 8.6942
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s679071g007genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF81.46e-261058250
                       ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
             SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                       rien  +rqvtf+kRr+g+lKKA ELSvLCda++ +iifs++gklye +
  PDK_30s679071g007 10 RIENPVQRQVTFCKRRAGLLKKARELSVLCDADIGIIIFSNHGKLYELA 58
                       8*********************************************965 PP

2K-box13.23.9e-0612615769100
              K-box  69 KnellleqieelqkkekelqeenkaLrkklee 100
                        K+++++++i+ l++ke  l+ +nk L++k+ e
  PDK_30s679071g007 126 KMQIMFQEIQLLKNKEGILKAANKILQEKITE 157
                        99***************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554554.19E-28174IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-35160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.52161IPR002100Transcription factor, MADS-box
CDDcd002654.26E-38371No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-27323IPR002100Transcription factor, MADS-box
PfamPF003192.9E-241056IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-273859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MPRGKVQMRR IENPVQRQVT FCKRRAGLLK KARELSVLCD ADIGIIIFSN HGKLYELATN  60
GDMQSLIERY KSIGAEAQLE GGEVNQPQVS ELEKLEISML KQEIDLLQKG ISNFRWLGNE  120
PHMAWKMQIM FQEIQLLKNK EGILKAANKI LQEKITEKNG LFDIGTVTEG IPYPLTIQDN  180
IFQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A8e-16190178MEF2C
5f28_B8e-16190178MEF2C
5f28_C8e-16190178MEF2C
5f28_D8e-16190178MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010912876.11e-102MADS-box transcription factor 26-like
SwissprotA2YQK92e-62MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G82e-62MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLA0A199VRK03e-74A0A199VRK0_ANACO; MADS-box transcription factor 33
STRINGXP_008782100.11e-110(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.15e-54AGAMOUS-like 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Lee S, et al.
    Further characterization of a rice AGL12 group MADS-box gene, OsMADS26.
    Plant Physiol., 2008. 147(1): p. 156-68
    [PMID:18354041]
  3. Khong GN, et al.
    OsMADS26 Negatively Regulates Resistance to Pathogens and Drought Tolerance in Rice.
    Plant Physiol., 2015. 169(4): p. 2935-49
    [PMID:26424158]