PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1201081g002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family bZIP
Protein Properties Length: 414aa    MW: 44874.9 Da    PI: 6.3261
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1201081g002genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.12.4e-10228286563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l +l+     l++e+
  PDK_30s1201081g002 228 KRAKRIWANRQSAARSKERKMRYISELERKVQTLQTEATTLSAQLAMLQRDTTGLTAEN 286
                         9*********************************************9998877777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-16224288IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.978226289IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.8E-11228280No hitNo description
PfamPF001709.0E-9228281IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.3E-11228282No hitNo description
CDDcd147031.48E-24229278No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MEKDKSPVHG GVGGGGGGLP PPSSRYTVFA SPSRSFPVKC EASSSSSIAG AAPESGHFSR  60
AAVPDAGQFS HDISGMPDYP PRNVGHRRAQ SEILSLPDDI SFDSDLGVVG SGEGPSLSDE  120
TEEDPLSMYL DMDKFTSFSE TSGLDLPGIE TSVTAPAPAP SFPCHTENSA SASKERPRVR  180
HQHSQSMDGS TTIKPEMLAS GSEGPSLAET KKAMSAAKLA DLTLVDPKRA KRIWANRQSA  240
ARSKERKMRY ISELERKVQT LQTEATTLSA QLAMLQRDTT GLTAENNELK LRLQTMEQQV  300
HLQDALNDAL REEVQRLKIA TGQAVPSGGQ MINFGPSFGA TQQYYQHNPA MQSLLAAQQL  360
QQLQIHSQHL QQMHLQQHQP QVQQQQQQSP AELKMKGVMT SQRESTSDNS TSQE
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008778608.10.0probable transcription factor PosF21
SwissprotQ040881e-133POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A2H3X5F50.0A0A2H3X5F5_PHODC; probable transcription factor PosF21
STRINGXP_008778608.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-133bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]