PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1192821g010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family bZIP
Protein Properties Length: 299aa    MW: 33243.5 Da    PI: 7.2608
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1192821g010genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.66.3e-092282781363
                         HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  13 NReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         NR +A rs +RK  +i eLe+kv++L++  ++L  +l +l+     l+ e+
  PDK_30s1192821g010 228 NRQSAARSKERKMRYIVELEQKVQNLQTDATTLSAQLTMLQRDTNGLTVEN 278
                         ***************************************998888777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.0E-8218280IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.27E-9225271No hitNo description
CDDcd147034.52E-18225270No hitNo description
PfamPF077162.5E-5228269IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.2E-10228274No hitNo description
PROSITE profilePS502179.002228281IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MERRDENGSR FYRGGRGHVG KGGGDGSRWG FSGTRDQVRW RERMRMAVIF RKQEDVLEEK  60
EHLKIWMGLG TMLNYLINFK DHFETFKLKG YDLGIVGLHD DADEDLFSAY FDAEKFNFPP  120
ASSSGLSGGE PSGLAAAPPA PSQTEKLASA ASNERPGARH QNSQSMDGSP SVLLGSSGEG  180
PGPGPTPAEM KKAMTDARLD DLALVDSKRA KRFIIIISHI LLYLIWANRQ SAARSKERKM  240
RYIVELEQKV QNLQTDATTL SAQLTMLQRD TNGLTVENSD LKLQLQTMEQ QVHLQDASV
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008788212.11e-116transcription factor RF2a-like
SwissprotQ040889e-56POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A2H3XSP81e-115A0A2H3XSP8_PHODC; transcription factor RF2a-like
STRINGXP_008788212.11e-115(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.12e-53bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]