PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1182771g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family MYB
Protein Properties Length: 943aa    MW: 106564 Da    PI: 8.8172
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1182771g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.74.6e-12451493346
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          WT++Ed +l  av+ +G ++W  +++ +  gRt+ qc +rw+k
  PDK_30s1182771g001 451 DWTEDEDAKLHAAVESFGDNNWQIVSSNLE-GRTGPQCSNRWRK 493
                         6*****************************.***********98 PP

2Myb_DNA-binding52.21.4e-16503547247
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         grW+ +Ed++l+ av ++G ++W++Ia+  + gRt  qc++rw++ 
  PDK_30s1182771g001 503 GRWSVDEDKRLKVAVMLFGAKNWNKIAQFAP-GRTQVQCRERWLNC 547
                         8******************************.***********996 PP

3Myb_DNA-binding46.11.1e-14557599448
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         WT+eEd +l+ a++++G   W++Ia  ++  Rt+ qc+ rw  +l
  PDK_30s1182771g001 557 WTEEEDAKLLAAIAEHGYC-WSKIATFVP-PRTDSQCRRRWKVLL 599
                         *****************99.*********.9**********9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF547917.34E-5165215IPR004088K Homology domain, type 1
Gene3DG3DSA:3.30.1370.103.9E-4167214IPR004088K Homology domain, type 1
PROSITE profilePS500906.249298388IPR017877Myb-like domain
SMARTSM007179.4E-4302392IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-9305321IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-9362402IPR009057Homeodomain-like
SuperFamilySSF466892.46E-10372427IPR009057Homeodomain-like
PROSITE profilePS500907.944391443IPR017877Myb-like domain
SMARTSM007170.54395445IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-11403450IPR009057Homeodomain-like
SuperFamilySSF466891.86E-19428498IPR009057Homeodomain-like
PROSITE profilePS5129419.172444499IPR017930Myb domain
SMARTSM007171.1E-11448497IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-15451497IPR009057Homeodomain-like
PfamPF002493.3E-10451493IPR001005SANT/Myb domain
CDDcd001679.08E-11452495No hitNo description
SuperFamilySSF466893.46E-28499595IPR009057Homeodomain-like
PROSITE profilePS5129413.108500548IPR017930Myb domain
SMARTSM007172.1E-14501550IPR001005SANT/Myb domain
PfamPF002492.1E-15503547IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-18503551IPR009057Homeodomain-like
CDDcd001673.42E-12504546No hitNo description
PROSITE profilePS5129423.834549603IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-18552599IPR009057Homeodomain-like
SMARTSM007174.1E-14553601IPR001005SANT/Myb domain
CDDcd001671.29E-13557599No hitNo description
PfamPF002491.3E-13557599IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0003723Molecular FunctionRNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 943 aa     Download sequence    Send to blast
MEALRRACML TGADPAAVND SDSDSGGESS STDDVDLLRR LQERFSVPSS DADSLPFIKP  60
LSSRPLPESD EEDDFETLRA IQRRFTQYDS DAQKKKSENF VQDTEMIVAD VTSERETRNI  120
VPKNSDSGFT EHAENESYSV NFGGFIQSQF PKSAQFFVDA LKKNRSFIED SRAGIKISPQ  180
DHTYVGLNDR LVTLSGSFEE QMRAVYLILL KLIEDAHYPQ TLNSPFSYAG GSKNFSIELA  240
CSSLWMHGTY DNFILVHFNS NTEMLRTKAS YKKVRALYFG PAENSHVSKF KMVLKRFPVS  300
LRKQKWSNME KEKLAKGLKQ QYQEMLILNS MNFESDVDSN LMSGLSSSDL DVTPEKIRSF  360
LPLVNWDRLA SMYVPGRSGE ECEARWLNCE DPMINHNPWT ILEDKKVLFV VQERGIYNWI  420
DISVALGSHR TPFQCLARYQ RSLNPHILNK DWTEDEDAKL HAAVESFGDN NWQIVSSNLE  480
GRTGPQCSNR WRKSLNPDRR KVGRWSVDED KRLKVAVMLF GAKNWNKIAQ FAPGRTQVQC  540
RERWLNCLDP SLNLKGWTEE EDAKLLAAIA EHGYCWSKIA TFVPPRTDSQ CRRRWKVLLP  600
HEVPLLQAAR KMKRTVLISN FVDRESERPA IGPNDFRPVV NFSEAENTDS MGPRKKRPSD  660
NQPKKSRVKS KRSLKENSTA DGVISSTETI LSDSALVRSK NFNTAEGGIK SDNKPKKLRA  720
KSTSVKENAI ADGMANSSAD IVPGDNSLVH IVNYTTAESG RIKRTRKMMP RVKSRGFCKE  780
NIMANGMLAQ ILILLEVGAL KEGAKECQVV INPGSLNLNP GLLKKTKQQL ACSDPQLMPS  840
RKCDARKRKE MFERKLSDNM VNYPDAEQQF TCFKERLTRY FVGWKVLDNI GTGAASEGET  900
NTGQVSQSNT VKEIHCEQDS RPADYGTLLV PTSQGEKKMG MLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-313656033159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-313656033159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1591612RRRWKVLLPHEVPLLQAARKMK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008809746.10.0PREDICTED: myb-like protein L
TrEMBLM0TBT60.0M0TBT6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P31410_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-156myb domain protein 4r1