PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1139331g005
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family bZIP
Protein Properties Length: 208aa    MW: 23627.1 Da    PI: 9.9553
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1139331g005genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.32.2e-1582132454
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                         l+r++r++kNRe+A rsR+RK+a++ eLe  v +Le+eN +L k  ee  k
  PDK_30s1139331g005  82 LQRQKRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLLKYQEEQHK 132
                         79**************************************99876665555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-979143IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.40481133IPR004827Basic-leucine zipper domain
PfamPF001707.4E-1482133IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.75E-1183134No hitNo description
CDDcd147076.30E-2283137No hitNo description
Gene3DG3DSA:1.20.5.1707.6E-1484133No hitNo description
PROSITE patternPS00036086101IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MTLEDFLARA GAVREEEVRV PSGSGQGNFG LDSVLGGDFG QQQQLPLENP VLGFGNGVEG  60
GGGRGGRRRK RLMLDPVDRV VLQRQKRMIK NRESAARSRE RKQAYTVELE SLVTQLEEEN  120
ARLLKYQEEQ HKERLQQVFY CIFSETDISL RINYIVDLIL FFLLTLGTQV RWMLTPGHAL  180
YGKTLGGTLK MNYRARRCAN KLSLMSYA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008793932.13e-74PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
TrEMBLM0S9P04e-52M0S9P0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P20490_0011e-51(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.12e-24G-box binding factor 4