PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1139221g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family GRAS
Protein Properties Length: 673aa    MW: 74198.8 Da    PI: 5.4653
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1139221g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4202e-1282826541373
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn....sseelaalklfsev 87 
                         lv+lL++cAe +ssg++e+++ +Larl elasp+g++m+R+aay++eALa r ++ +++++++ pp++ ++++     ++ ++al+l+++v
  PDK_30s1139221g001 282 LVSLLTSCAESISSGNHEAISFFLARLAELASPTGSSMHRVAAYYAEALALRAVKLWPHIFSITPPRALADQTggggADDDATALQLLNQV 372
                         689*******************************************************************9999**999************ PP

                GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                         sPi kf hlt N+ +l+a+eg++rvHiiDfdi+qGlQWp L+q+La R+++p ++RiTg+g+     ++el+ tg rLa+fAe++++pfef
  PDK_30s1139221g001 373 SPITKFLHLTLNERLLRAFEGKDRVHIIDFDIKQGLQWPGLFQSLAGRANPPSHVRITGIGE----CRQELQDTGARLARFAEACNLPFEF 459
                         **************************************************************....************************* PP

                GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                         ++ v++rled++l++L+vk+++++aVn+vl+lh++l ++ +      ++L l++s++P +v ++eqea+hn++++ +r++++l+yysa+fd
  PDK_30s1139221g001 460 HA-VVDRLEDVRLWMLHVKREDCVAVNCVLMLHKTLYNDENGGA-LMDLLGLIRSTNPAIVLMAEQEAQHNETRWEARLANSLKYYSAIFD 548
                         **.7********************************77777766.999******************************************* PP

                GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve...eesgs 357
                         sl+ +lp++s +rik+E++ ++rei+n+vaceg+er+ rhe++e+Wr+ +e+ GF+ + ++e+++ q +l+lr+++++ ++++   ee++ 
  PDK_30s1139221g001 549 SLDCGLPEDSLARIKIEEM-FAREIRNLVACEGSERVDRHEKFERWRKLMEDGGFRCMGIGEREMLQSRLILRMYDGENFSIDkqgEENDG 638
                         *******************.********************************************************999***977777*** PP

                GRAS 358 lvlgWkdrpLvsvSaW 373
                         l+l W +++L++vSaW
  PDK_30s1139221g001 639 LTLKWLNQSLYTVSAW 654
                         **************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.682256632IPR005202Transcription factor GRAS
PfamPF035146.8E-126282654IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 673 aa     Download sequence    Send to blast
MLAGCSSALL SPRHQLRSEA SVQVQGSHFQ LQERHCTSQQ RMGTQRFDLP CSFSRKDAPR  60
VAISLEKPAE ARSSSCAFRP SPATASSSSV AARALSWEGR IEIAEGGGPW ERRRSSKRRS  120
HERSSSEEDS RPDRAKRTRT GGAARLAGGE DDIWLPQSTK EHPSVEEEEE KEEEEEEEEE  180
EEKKVFLVPN AALFPFFTTT SSTLVGSFEA GRGLGTGVQP NNKSQSDSSS SSDARNSSPK  240
QHKDSSDNAA RNGPEIAHPT GFAGIAGQGG GNAQTEQQGL ELVSLLTSCA ESISSGNHEA  300
ISFFLARLAE LASPTGSSMH RVAAYYAEAL ALRAVKLWPH IFSITPPRAL ADQTGGGGAD  360
DDATALQLLN QVSPITKFLH LTLNERLLRA FEGKDRVHII DFDIKQGLQW PGLFQSLAGR  420
ANPPSHVRIT GIGECRQELQ DTGARLARFA EACNLPFEFH AVVDRLEDVR LWMLHVKRED  480
CVAVNCVLML HKTLYNDENG GALMDLLGLI RSTNPAIVLM AEQEAQHNET RWEARLANSL  540
KYYSAIFDSL DCGLPEDSLA RIKIEEMFAR EIRNLVACEG SERVDRHEKF ERWRKLMEDG  600
GFRCMGIGER EMLQSRLILR MYDGENFSID KQGEENDGLT LKWLNQSLYT VSAWAPTDIA  660
TDIAGSSATS QPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-4230565426374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1116120KRRSH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010940885.10.0PREDICTED: scarecrow-like protein 28
TrEMBLM0TF250.0M0TF25_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P05850_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-141GRAS family protein