PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1100981g009
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family CPP
Protein Properties Length: 152aa    MW: 16368.7 Da    PI: 9.1831
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1100981g009genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR543.3e-171251140
                 TCR  1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40
                        k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  PDK_30s1100981g009 12 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNYE 51
                        589***********************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5163420.591152IPR005172CRC domain
SMARTSM011146.2E-201253IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.4E-131550IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MEEAGDLPLL GKHNKGCHCK KSGCLKKYCE CFQANILCSE NCKCMDCKNY EGSEERRALF  60
RGDHGNALYM QHAANAALNG AIGPSGFLSP STSKKRKNPE LFLSTSSKDQ PIHRLGQASH  120
LKTSGPAASF PSVPVARAVN PAPLGSSKVT YR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008789327.11e-105PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SL702e-53TCX6_ARATH; Protein tesmin/TSO1-like CXC 6
TrEMBLM0TXZ22e-77M0TXZ2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P06330_0014e-77(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47303657
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20110.11e-54Tesmin/TSO1-like CXC domain-containing protein