PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1100871g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family Trihelix
Protein Properties Length: 302aa    MW: 33710.5 Da    PI: 4.4316
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1100871g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix39.71.3e-1263137278
            trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessst 78 
                         Wt +e l+L+     ++e+  ++ +  ++W+ +s+++ +  + rs++qCk kwe+l  +y +i+++e++  +++ s 
  PDK_30s1100871g001  63 WTTHEMLVLVSEIAAVDEDWVKALSSYQKWKMISDNCVAFDVIRSSNQCKRKWESLLADYWRIRDWESR--CGVGSY 137
                         *******************************************************************98..666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138378.2E-962163No hitNo description
PROSITE profilePS500907.13163119IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009506Cellular Componentplasmodesma
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MERTETPCIV QALPASNKKD KESLTKPVTV EDKESPLKLE STTNSPQTPS SSRFTRSQAA  60
PDWTTHEMLV LVSEIAAVDE DWVKALSSYQ KWKMISDNCV AFDVIRSSNQ CKRKWESLLA  120
DYWRIRDWES RCGVGSYWCL EGEKRKQFGL PALFDEEVFD SMDAVIKAQE TQSSSRDSDS  180
EGLVGTADVQ MADGDDDLGS GEKEPNETLT NTDKGRDMAM KLQEDAQHIH AILKGELEDS  240
SSQVRAPVDL TKPNAIETEF TRRQANELIK AFGSLVSTLN QFTELIKDGE CEGIKPVTST  300
AQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008781712.10.0PREDICTED: uncharacterized protein LOC103701445 isoform X1
TrEMBLM0S0681e-104M0S068_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P15600_0011e-104(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63532433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31270.14e-43sequence-specific DNA binding transcription factors