PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1085001g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family GRF
Protein Properties Length: 377aa    MW: 42938 Da    PI: 8.6081
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1085001g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.61.3e-2489132144
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                         d+epgrCrRtDGKkWRCs+++++++k+CErH+hrg++rsrk++e
  PDK_30s1085001g001  89 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE 132
                         79***************************************987 PP

2QLQ60.64.4e-211853237
                 QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                        +FT++Q+q+L++Q+l++Ky+a++ P+P++L++++++
  PDK_30s1085001g001 18 PFTPSQWQELEHQALIFKYMASGIPIPSDLVLPLRR 53
                        9********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.2E-111753IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.2171853IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.5E-151851IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.66589133IPR014977WRC domain
PfamPF088791.3E-2090132IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
LWSGFEMMMS RRNSSRYPFT PSQWQELEHQ ALIFKYMASG IPIPSDLVLP LRRSFLLDST  60
IPSPTLAFHP QPSMSWGWNQ KGFGRKAEDP EPGRCRRTDG KKWRCSKEAY PDSKYCERHM  120
HRGKNRSRKP VEMYLATSLP SSTSSSTTTT TTTAAATTAA TNNSNNNLVI PDSYHLLYTC  180
HPSSRTPGVG LNTPHFNLHT PSYTQADKDY RYCHGMKDVD EYCFFSEASG SEKESSWQFR  240
PLGMSLLGDT KQGSSALQQS TYSHCGRDAE EKQQHCFVLG ADFKLERPLK VEREQEEGRR  300
PLRHFFDEWP QKSRDSWVDL ERENSNQAAA YSKTQLSISI PMSHHDFPVT ASRNRNGAVL  360
IAQCPLHPNT LLSSFSY
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00263DAPTransfer from AT2G06200Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4680355e-39AM468035.1 Vitis vinifera contig VV78X155042.5, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010932423.20.0growth-regulating factor 1
SwissprotQ6AWY83e-91GRF1_ORYSJ; Growth-regulating factor 1
TrEMBLA0A2H3XPD21e-173A0A2H3XPD2_PHODC; growth-regulating factor 1-like
STRINGXP_010273920.11e-104(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.14e-49growth-regulating factor 5