PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1083451g003
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family Dof
Protein Properties Length: 290aa    MW: 31104.7 Da    PI: 7.9345
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1083451g003genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof128.12.6e-403293263
              zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                        +e++lkcprCdstntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk+sss
  PDK_30s1083451g003 32 PEQNLKCPRCDSTNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNKRSSS 93
                        7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.9E-333490IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5533690IPR003851Zinc finger, Dof-type
ProDomPD0074785.0E-233685IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MATLPLEEVL AGCPKTQQQQ QQQQERKPRP QPEQNLKCPR CDSTNTKFCY YNNYSLSQPR  60
YFCKGCRRYW TKGGSLRNVP VGGGCRKNKR SSSSTSKRAQ DQALATNSKP PLPTLLPPPL  120
SYDPSDLSLA FARLHKPPTA CQLGLDDHDP FLLGNPNTNP GHIPAATPGF LDILRGGLLD  180
TATTTSGFHN LYYGFGGHGS VEQVEDSVAG EEAVLPFDGG LSGATTTTTS STPTASQGSC  240
RAADGGESKV FMGLQWQVGT EGNMAAMDPG RDYWNGGGSS WPGLINSSLM
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM3665461e-63HM366546.1 Prunus persica clone PpDOF1 Dof-type zinc finger domain-containing protein mRNA, complete cds.
GenBankHM3665471e-63HM366547.1 Prunus persica clone PpDOF2 Dof-type zinc finger domain-containing protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008792304.10.0dof zinc finger protein DOF3.2
TrEMBLA0A2H3Y2Q30.0A0A2H3Y2Q3_PHODC; dof zinc finger protein DOF3.2
STRINGXP_008792304.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.13e-30TARGET OF MONOPTEROS 6