PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1082541g003
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family GRF
Protein Properties Length: 310aa    MW: 34857.1 Da    PI: 8.2124
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1082541g003genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC73.91.8e-2378121144
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                         d+epgrCrRtDGKkWRCs+++++++k+CErH+hrg+  srk++e
  PDK_30s1082541g003  78 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKRSSRKHVE 121
                         79****************************************97 PP

2QLQ58.91.5e-201247237
                 QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                        +FT +Q+q+L++Q+l++KyLa++ P+P +L+++i++
  PDK_30s1082541g003 12 PFTESQWQELEQQALIFKYLARGIPIPNDLILPIRR 47
                        9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.1E-111147IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.3E-151246IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.9141247IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.02878122IPR014977WRC domain
PfamPF088799.5E-1979121IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MIGGSGSRSR YPFTESQWQE LEQQALIFKY LARGIPIPND LILPIRRSLL LDSPTLGFPH  60
PPIGWGCFQM GYGRKIEDPE PGRCRRTDGK KWRCSKEAYP DSKYCERHMH RGKRSSRKHV  120
ELSLASNPTS SHLSSPYSPL LSLSPPEAHH VPFPCSSSSG SPSIGFSTQN SIPYSHLDTA  180
CLSADTSNRE FYGLKKDVNE YNFFSEAYEA EREGKFRPLG LTSKNELRQS SDHNMITNSN  240
LAVALASEDI KVVGLEDSQK PKPFHCFFDD WPQRGKGPCI SMEEDRSKQA SYSNTQLSIS  300
SSLYHNGLML
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ8305372e-75KJ830537.1 Elaeis guineensis clone TS1MS38 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010936937.10.0growth-regulating factor 1
TrEMBLA0A3Q0HQP21e-176A0A3Q0HQP2_PHODC; growth-regulating factor 1-like
STRINGXP_008777426.11e-174(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.16e-50growth-regulating factor 5