PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1074581g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family Trihelix
Protein Properties Length: 314aa    MW: 35245.1 Da    PI: 9.2952
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1074581g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix27.39.5e-094444486
            trihelix 44 erspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86
                        +++p qCk+k+e+++kry+++ + + +  ++s+s+++++ +++
  PDK_30s1074581g001  4 HKTPSQCKNKIESMKKRYRAESAAAHE--PNSRSSWQFYARMD 44
                        789*****************9999998..788888******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138373.3E-10445No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MKGHKTPSQC KNKIESMKKR YRAESAAAHE PNSRSSWQFY ARMDGLLKGT PNCSAQPKSH  60
HDINLQALPK VENEVDVMGR LQDSNQDDAS NTSPVDGEAV KNDNVDKKES RGDSDGSAPR  120
SKAANAEDKA GRDGNPSKRR KESGNEVADS IRLLAESILK VEQAKMEMYK DSERMRADAE  180
IKRGEMELKR TEIIAKTQLQ IAKLFAKKSQ GRSSKTEGSS LRTEFDMLPT RDGTVFCTKI  240
TIDFLIHIIF PAFNVKVFFL PISVKVALAY GYATFNMGSL RFTLLLNYYC TFRCSLFKDL  300
ECIYGHVILL NLDP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008789713.11e-170PREDICTED: uncharacterized protein LOC103707119
TrEMBLM0SLF63e-99M0SLF6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P05890_0018e-99(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP73333346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54390.12e-38sequence-specific DNA binding transcription factors