PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1064101g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family Nin-like
Protein Properties Length: 912aa    MW: 101195 Da    PI: 6.4148
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1064101g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.99.5e-29599649252
              RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ek+isl++l+kyF++++kdAAk+Lgvc+T+LKriCR++GI+RWP+Rkik++
  PDK_30s1064101g001 599 EKTISLQELRKYFAGSLKDAAKSLGVCPTTLKRICRHHGISRWPSRKIKKV 649
                         79***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.018588669IPR003035RWP-RK domain
PfamPF020421.1E-25601649IPR003035RWP-RK domain
SuperFamilySSF542772.06E-23814903No hitNo description
Gene3DG3DSA:3.10.20.2405.4E-24816899No hitNo description
PROSITE profilePS5174525.829818901IPR000270PB1 domain
SMARTSM006661.5E-26818901IPR000270PB1 domain
CDDcd064073.46E-40819900No hitNo description
PfamPF005641.3E-17819900IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 912 aa     Download sequence    Send to blast
MDLMDEFLSV AGLDCSDLLQ PGTSTSTSPF NSSGFSPLFE VGNGGGSNPV LPENDNQDDA  60
EWSVFSVDLP SDEIPIELLN ELRAKNPSSE LGSSWWIRPS TRMGTMEERL IRAINYVKDS  120
RRDGDVLVQI WVPTRMGERH VLTTCGQPFT LDSSCQRLVN YRTVSTRYQF SAEENSNVAQ  180
GLPGRVFLGR VPEWTPDVRY FSSYEYPRVN DAQRYDVRGS LALPVFERNS RSCVGVLEVV  240
MTTQKINYSS DLEGVCNALQ AVDLRSSEVS GVPRVMVFNE SYRVVLPEIQ RVLRAVCKTH  300
SLPLAQTWIS CIQQGKSGSR HSDENYKDCV STVDVACYVQ DPTMLGFHQA CSEHHLLKGQ  360
GVAGKAFTTN QPCFSSDITS FSKTEYPLSH HAKLFHLRAA VAIRLRSNHT GTADFVLEFF  420
LPFKCIESEE QKLMLNSLSI TIQQVCQSLR VVTSKELEHE AVLPVSELNS SNALLDKFVS  480
ETSQRLDDDD DNLLTESPTI GISGEVSSWI ASIRETQEKR GKSVLPASVP LDFYKQEIEG  540
LSVWDRSEVV LPAGKIFSEF KPHEEEFLRD SFDPKNSFAG EPGFSNTGKA MEKRRTKTEK  600
TISLQELRKY FAGSLKDAAK SLGVCPTTLK RICRHHGISR WPSRKIKKVG HSLRKLQVVI  660
DSVHGPDGAF QFSSLYENFT KATWSNESLL GSTTFSTLKQ KDNPESSNTN QQQEAKLSSH  720
TSGSNSPSSS SSSHSSGSSL GCSSGTKQCS NAQLAIQQEI SVEENQSGML NKIQIPIELQ  780
LSTEDAPISL GRSQNHKLLS EHPFSGTHAA LHKSRHDSLK VKAIYGEDKV ILGLQPTWGF  840
QDLKQEIGKR FNIGNINLVA LKYLDDDSEW VLLTCDADLQ ECIDVYKSSS ARTIKISVHH  900
VPQKITSSSG IA
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017702242.10.0protein NLP1-like
RefseqXP_026655950.10.0protein NLP1-like
SwissprotQ10S830.0NLP1_ORYSJ; Protein NLP1
TrEMBLA0A2H4A0L60.0A0A2H4A0L6_PHODC; protein NLP1-like
STRINGXP_008812750.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110253241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]