PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1040661g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family GRF
Protein Properties Length: 332aa    MW: 37504 Da    PI: 6.9772
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1040661g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC70.52.1e-2276119144
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                         d+epgrCrRtDGKkWRCs+++ +++k+CErH+hrg+  srk+++
  PDK_30s1040661g001  76 DPEPGRCRRTDGKKWRCSKEACPDSKYCERHMHRGKRSSRKQVD 119
                         79**************************************9986 PP

2QLQ53.85.9e-19944237
                 QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                        +FT +Q+q+L++Q+ +++yL+++ PvP +L+++i++
  PDK_30s1040661g001  9 PFTESQWQELEHQAIIFRYLVSGIPVPNDLILPIRR 44
                        9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.5E-10844IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.174944IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.3E-13943IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.57676120IPR014977WRC domain
PfamPF088796.9E-1877118IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MRGSRSRYPF TESQWQELEH QAIIFRYLVS GIPVPNDLIL PIRRSHLLDF PTLCFPHLPP  60
AGWGCFQMGC GRKVEDPEPG RCRRTDGKKW RCSKEACPDS KYCERHMHRG KRSSRKQVDL  120
SLASNPTSSR LSSPYSSLLS LSPPEADRAL FPSSSSSGSP SISLSAQNNI PYSHLDTVSL  180
SADKSNRELY GLKEDVNEYN FFSEDSRAER EGKFRPLVLS SMGEIQQSSD QNLITNFAIA  240
LASEEDKVVE SEGDSRKASS FDCLFDEWPE RSTGAWISLE ENQSKRASYS NTQLSISSSQ  300
YHNGLMVFTL SEHPIYPSVI RCFNIHPPFF II
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010939918.20.0growth-regulating factor 1 isoform X2
TrEMBLA0A3Q0I2N41e-168A0A3Q0I2N4_PHODC; growth-regulating factor 1-like
STRINGXP_008787840.11e-168(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.13e-47growth-regulating factor 5