PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1039581g002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family Dof
Protein Properties Length: 300aa    MW: 32592.6 Da    PI: 7.3035
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1039581g002genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.34.7e-4053112261
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                         +++alkcprCdst+tkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk+s
  PDK_30s1039581g002  53 QDQALKCPRCDSTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNVPVGGGCRKNKRS 112
                         7899******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2951111IPR003851Zinc finger, Dof-type
PfamPF027011.7E-3354111IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.35757111IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105995IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MVTPSMRICM DSSHDWLKGI VHEDGGMGSS SPSGEPISCS RPPVMERRLR PQQDQALKCP  60
RCDSTHTKFC YYNNYSLSQP RYFCKTCRRY WTKGGSLRNV PVGGGCRKNK RSGAKKPSEQ  120
PPHPVSSFQN GTDLHLSFSG VQFPHLDSLT DTPRNLNFME CRYNPMHGFS SAGDLDLMDT  180
KFGAMLGSSR GHIFMGEAGV GLGEASHGFA LGAGFHGVSP LGFSADGNHG ALVEACQRLT  240
LPFEAQEEPN AAEVKPDSRI LSLEWQDQCC ADAGHESGGY SNNLGLWAGM INVHGSSTTI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008795919.10.0dof zinc finger protein DOF5.6-like
TrEMBLA0A2H3YAK20.0A0A2H3YAK2_PHODC; dof zinc finger protein DOF5.6-like
STRINGXP_008795919.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.18e-37Dof family protein