PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1025391g002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family G2-like
Protein Properties Length: 357aa    MW: 39598.4 Da    PI: 4.5543
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1025391g002genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.91.7e-31198252256
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         +r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  PDK_30s1025391g002 198 ARRCWSPDLHRRFVNALQILGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 252
                         699**************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.213194254IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-27196255IPR009057Homeodomain-like
SuperFamilySSF466892.51E-15198255IPR009057Homeodomain-like
PfamPF002491.6E-6199250IPR001005SANT/Myb domain
TIGRFAMsTIGR015576.2E-26199252IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MGSPSDLSLD YKPNSYPMIQ KPLGEQPDQT QKIQEFLARL EEERLKIEAF KRELPLCMQL  60
LNNAVETYRQ QLETYQTNQA PRPVLEEFIP LKHASIDGSE KAPNAPSEKA SWMVSAQLWS  120
AANDATRNQP MAAPPLKETE HAFDVSPKLA LDTKQRNGGA FLPFSKEKNK GMGSASRGLP  180
ELALASSEKA VEEKQSCARR CWSPDLHRRF VNALQILGGS QVATPKQIRE LMKVDGLTND  240
EVKSHLQKYR LHTRRPIPAP QASVAAAPQL VVLGSIWVPP ELGSPESEMR SGGERSESIE  300
EEEEGEEREE EEEEEEEEEE EDVEPATDGK AEEKALVPLA VKAEEGGGRG GEVALKI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A5e-14198250254Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-14198250254Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-14198250254Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-14198250254Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008792133.10.0transcription factor NIGTH1
SwissprotQ9ZQ853e-97EFM_ARATH; Myb family transcription factor EFM
TrEMBLA0A2H3Y1Q20.0A0A2H3Y1Q2_PHODC; transcription factor NIGTH1
STRINGXP_008792133.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97733338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.17e-89G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]