PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr041959.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family SBP
Protein Properties Length: 1154aa    MW: 128069 Da    PI: 8.1557
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr041959.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.13.3e-40148225178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cqv++C++dls+ak+yhrrhkvCe+hsk+++ lv++++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+qa
  Pbr041959.1 148 MCQVDNCKEDLSNAKDYHRRHKVCEIHSKSTKSLVAKQMQRFCQQCSRFHLLSEFDEGKRSCRRRLAGHNRRRRKTQA 225
                  6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.3E-33142210IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.881146223IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.85E-37147226IPR004333Transcription factor, SBP-box
PfamPF031103.2E-28149222IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1154 aa     Download sequence    Send to blast
MENAGGQVAA PIYFHQTLSG RFCDSPAMGR KRDHPYQGPN YQHPHLQQLR VTNPGNNWNP  60
NVWDWDAVRF VAKPLDSEME QLGTTFTTEQ RNKEEATGPV KNMAEDEHDE SLQLNLAGGF  120
TSVEEPVPRP NKRVRSGSPG NGNGSYPMCQ VDNCKEDLSN AKDYHRRHKV CEIHSKSTKS  180
LVAKQMQRFC QQCSRFHLLS EFDEGKRSCR RRLAGHNRRR RKTQAEDVTS RLTLPGGGDN  240
KSIGNIDIVN LVADIARPQG XXXXXXXXXX XXXXXXVGKN DVRNINGSSV LDREQLLQIL  300
SKMNSLPLPA DLAAKLPNLE SLTRKASELL SLDLQNKLNG RASTATMDLL TVLSATLATS  360
APEALAMLSQ KCSQSSDSEK TKLTCSDQAA GPNLHKIPPQ EIHSAGGERS STSYQSPMED  420
SDCQVQETRV NLPLQLFSSS PENDSLPKLA SSRKYFSSDS SNPTEDRSPS SSPPVVHTLF  480
PMKSLAETVK SEKLLVSKEV SANPDSSRTC RSNMPFDLFR GSNRGAEATS IQSFPNQPGY  540
TSSSSDHSPS SLNSDAQDRT GRILFKLFDK DPSHLPGTLR TQIYNWLSNS PSEMESYIRP  600
GCVILSVYVS MPPASWEQLE ENLVQHASSL VQSSDSDFWR SGRFLVNTGR QLASHKDEKI  660
RTCKAWRSCS SPELISVAPL AVVGGQETSL LLRGRNLNTL GTRIHCTYMG GYTSKEATGS  720
AYHGMMFDEI NLGSFQIHDA SPGVLGRCFI EVENGFRGNS FPVIIADATI CRELKVLESV  780
FDAESKVCDV ISEDESHDYG RPTSREEALH FLNELGWLFQ RKRICSMLQE PHYALSRFKF  840
LLTFSVEKDC CALVKTLLDI LFERNFDSDT LSGGSVMLSD MQLLNRAVKR RCRKMVDLLI  900
NYSIVNSDID KRYIFPPNLA GPGSMTPLHL AACMSSTDDM IDALTNDPQE IGLNCWNSLL  960
DASGQSPYAY ALMRNNYSYN NLVARKLADR RNSQVTVTIG NERDQPQMSM ELEHRTNTRS  1020
RQGSRSCTKC AIAATKYSRR VPGAQGLLQR PLIHSMLAIA AVCVCVCLFL RGSPDIGLVA  1080
PFKLALWSRW KIEVFCLAAF KRMRRGVMAD LINKRILNQA QVFGDSDAGC LSPTNLRHVH  1140
SLGLLCSFVS RNG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-29141222384squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1885890RAVKRR
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr041959.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009347080.10.0PREDICTED: squamosa promoter-binding-like protein 14
RefseqXP_018500865.10.0PREDICTED: squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A498HMP40.0A0A498HMP4_MALDO; Uncharacterized protein
STRINGXP_009347080.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]