PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr041852.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family HD-ZIP
Protein Properties Length: 304aa    MW: 34222 Da    PI: 7.0554
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr041852.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.25.9e-1885137456
                  -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  + +++ eq+++Le+ F   +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  Pbr041852.1  85 KKRLNLEQVKTLEKSFDIGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 137
                  4568889*********************************************9 PP

2HD-ZIP_I/II128.72.4e-4183173191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  ekk+rl+ eqvk+LE+sF+  +kLeperK++la++Lglqprq+a+WFqnrRAR+ktkqlEkdy++L++++dalk++n++L++++++L++el
  Pbr041852.1  83 EKKKRLNLEQVKTLEKSFDIGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLEKDYDVLRNKFDALKADNDALQAHNKKLQAEL 173
                  69**************************************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.22E-1967141IPR009057Homeodomain-like
PROSITE profilePS5007116.94179139IPR001356Homeobox domain
SMARTSM003891.5E-1782143IPR001356Homeobox domain
CDDcd000861.09E-1584140No hitNo description
PfamPF000463.3E-1585137IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.9E-2087146IPR009057Homeodomain-like
PRINTSPR000311.1E-5110119IPR000047Helix-turn-helix motif
PROSITE patternPS000270114137IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5119135IPR000047Helix-turn-helix motif
PfamPF021835.8E-15139179IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MMAFPPCHSF MFQTHEDPDL HLANSSCPPQ HFHGGGMPFM MKRSLSFSGV ENNRCHHHDQ  60
EAALHGGGGG DDDLSDDGSQ MGEKKKRLNL EQVKTLEKSF DIGNKLEPER KMQLAKALGL  120
QPRQIAIWFQ NRRARWKTKQ LEKDYDVLRN KFDALKADND ALQAHNKKLQ AELLALKSKD  180
SSNEGGFNFK KETDPGSWSN GSENSSDHHH HHHLNLEISR TTATTSSPPS DSPQMNGKNL  240
FRPSSSSLRS ASTTHLLQGS SRSDLQSLKL DQMIQDEGLC SMFNGIDQEQ QGFWPWPEQQ  300
HFH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1131139RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr041852.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009347054.10.0PREDICTED: homeobox-leucine zipper protein HAT7
SwissprotQ004666e-80HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLA0A498HJM90.0A0A498HJM9_MALDO; Uncharacterized protein
STRINGXP_009347054.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.11e-72homeobox 3