PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr039458.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family ARR-B
Protein Properties Length: 580aa    MW: 64780.9 Da    PI: 6.7489
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr039458.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like83.81.8e-26316370156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k +++WtpeLH++Fv+a+eqL G ++A+P++i++lmk +gLt+++v+SHLQkYR++
  Pbr039458.1 316 KMKVDWTPELHKKFVKAIEQL-GVDQAIPSRIVDLMKTEGLTRHNVASHLQKYRMH 370
                  5689*****************.********************************96 PP

2Response_reg32.44.7e-12201261109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTT.SEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTE CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempg.mdGlellkeireeepklpiivvtahgeeedalealkaGa 94 
                   vl+ d + + ++ +r  le  +y +v+++ + +eal  +  +   +++ ++ ++  +   G+++l++ +e    lpii+ +     +++ +++ +Ga
   Pbr039458.1  20 VLLLDGDTTSASQIRLNLEAMDY-IVTAFCNETEALSAFSSNPesFHVAIIEVNANNgHWGFQFLETAKE----LPIIMTSNIHCLSTMMKCIALGA 111
                   7888999999999**********.***************777777**********99899**99998766....77888887777************ PP

                   SEEEESS--HHHHHH CS
  Response_reg  95 kdflsKpfdpeelvk 109
                    +fl Kp+++++l++
   Pbr039458.1 112 VEFLLKPVSEDKLRN 126
                   ************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23005.0E-1716159No hitNo description
SuperFamilySSF521723.98E-1716134IPR011006CheY-like superfamily
SMARTSM004481.0E-518128IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011021.54319132IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.6E-820127IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.60E-921131No hitNo description
PROSITE profilePS5129414.03313372IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-25314372IPR009057Homeodomain-like
SuperFamilySSF466896.81E-17315373IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-23316371IPR006447Myb domain, plants
PfamPF002493.6E-7319368IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 580 aa     Download sequence    Send to blast
MVCTANDLQQ WNDFPKGLRV LLLDGDTTSA SQIRLNLEAM DYIVTAFCNE TEALSAFSSN  60
PESFHVAIIE VNANNGHWGF QFLETAKELP IIMTSNIHCL STMMKCIALG AVEFLLKPVS  120
EDKLRNIWQH VVHKAFNAGG SPISETLKPV KVSVVSMLQP KQENEEQNCK ISIETENIIR  180
VHENDQEQSA GSDKYPAPST PQIKQGSRLL DHGDCQYQIN CMSEKVSGEN DSEAKSIETM  240
FCNPIDERNL HTREPHHMPR KTVIKEENDS GDGSKSEVNM SHHPDNIDSG NDNGGAAENL  300
SKASVPNTSC KSNRKKMKVD WTPELHKKFV KAIEQLGVDQ AIPSRIVDLM KTEGLTRHNV  360
ASHLQKYRMH KRHILPKDED QRLLWPHHPP GARDPTHQTS YYPRSHRPIM AFPPYHYNNT  420
TLSMPPAYPM WGSQPPAGSH PATVQMGGQP GYPHSYWQLS DQSWQYWNPY PGMQAEAWGC  480
PVMPPEQGGY SSYPQNASGF RSAGGHVVEN GHRYSMPRNS FNIHLSEDVV DKVMKEAISK  540
PWLPLPLGLK PPSTEGVLAE LTRQGICNIP QINGSHTQG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-15314369358ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr039458.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018500549.10.0PREDICTED: two-component response regulator-like APRR2 isoform X1
RefseqXP_018500550.10.0PREDICTED: two-component response regulator-like APRR2 isoform X1
SwissprotQ6LA431e-139APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLA0A498HIV60.0A0A498HIV6_MALDO; Uncharacterized protein
STRINGXP_009345638.10.0(Pyrus x bretschneideri)
STRINGXP_009345641.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35663465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-143ARR-B family protein
Publications ? help Back to Top
  1. Gong L, et al.
    Transcriptome Profiling of the Potato (Solanum tuberosum L.) Plant under Drought Stress and Water-Stimulus Conditions.
    PLoS ONE, 2015. 10(5): p. e0128041
    [PMID:26010543]