PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr038812.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family G2-like
Protein Properties Length: 417aa    MW: 45070.6 Da    PI: 7.3912
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr038812.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.8e-32297350255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Pbr038812.1 297 PRMRWTTSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 350
                  9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15294351IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28295351IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-23297350IPR006447Myb domain, plants
PfamPF002492.3E-7298349IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MLHEKRFSSE AAAGGRSSLS LNPIPDLSLH ISPPDTNTNS APSSICTDRA TPDHDSASCF  60
NIWRRDTDED DTNGGALTNK SHSDSCIRAS YTSSSPVAAD ADTELSLANP SASEAESAWK  120
KNYFGGGDVY HDEGKNNSNS VSSSNKIPLL ERLNPIKGIP VYSTSSTNCS FPPTFSPKPV  180
YQTAPYLSNS FRPAAPAGNC SGMGMGIGMG LGGFNGITMD SLSLGVGGVQ PQQPQHQRQH  240
YFPSYNLNPH YPQQHHCVGG GGNYNADLSS NGFIMRSRFT PPKLIGQNIN KRNMRAPRMR  300
WTTSLHARFV HAVELLGGHE RATPKSVLEL MDVKDLTLAH VKSHLQMYRT VKNTDKPLAS  360
SDGSGDEDLL STTNHHHNSN SNGLLNQRGA SNATLNLEHD HMEHHPSNNL WGNSSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-17298352458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-17298352458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-17298352357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-17298352357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-17298352357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-17298352357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-17298352458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-17298352458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-17298352458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-17298352458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-17298352458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-17298352458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr038812.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009360037.10.0PREDICTED: transcription repressor KAN1-like
TrEMBLA0A498I6Q20.0A0A498I6Q2_MALDO; Uncharacterized protein
STRINGXP_009360037.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-38G2-like family protein