PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr037101.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family M-type_MADS
Protein Properties Length: 364aa    MW: 41803.7 Da    PI: 9.1298
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr037101.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF64.41.2e-201353343
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                 i n++ r++tf kRr+gi+KKA+E S+LC+++v++ii++++
  Pbr037101.1 13 IANERSRKTTFQKRRKGIMKKAYEFSTLCEVDVCMIIYGPK 53
                 89*************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.0E-20360IPR002100Transcription factor, MADS-box
PROSITE profilePS5006619.918353IPR002100Transcription factor, MADS-box
CDDcd002666.53E-24481No hitNo description
SuperFamilySSF554551.24E-214100IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-10525IPR002100Transcription factor, MADS-box
PfamPF003192.5E-191352IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-102540IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MNMGRGRLNM ELIANERSRK TTFQKRRKGI MKKAYEFSTL CEVDVCMIIY GPKLTDRPPE  60
LQTWPKNPEE VSRIINKYKA STMCKPAKKT FDLSDLLMDR KNKVYADIYR KRKEMYETKY  120
PAWDERINTF SESQLEALLN ALDAKLESGK RILLNRKKEA AGHQILVMKK EAPTLLMGGK  180
PDVGESSSRK HPCNYEEDQN HMSSFSNNMV DHMLQQFPHQ PYDQMLQFDN SNEYLSNLLA  240
PNPGPTAMWM LRESNCSLQF SAGASGSNSQ FPVAGNQGNF SDPMMIHSTV ENTNMNMLMV  300
NNNLNPPRSS YMSQQYYARL MQPAVPYMQY PVMPASISSH PVQLRASQAK DDQYQDVNHY  360
LWS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr037101.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009341327.10.0PREDICTED: agamous-like MADS-box protein AGL82
TrEMBLA0A498HFG80.0A0A498HFG8_MALDO; Uncharacterized protein
STRINGXP_009344134.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.11e-24M-type_MADS family protein