PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr036239.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family ARR-B
Protein Properties Length: 638aa    MW: 71261.1 Da    PI: 6.4222
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr036239.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like75.95.2e-24199252155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k+r++W+ +LH++Fv+av+q+ G +k  Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Pbr036239.1 199 KARVVWSVDLHQKFVKAVHQI-GFDKVGPKKILDLMNVPWLTRENVASHLQKYRL 252
                  68*******************.9*******************************8 PP

2Response_reg80.74.8e-27191271109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vdD+p+ +++l+++l+k  y ev+++  ++eal ll+ek+  +D+++ D++mp+mdG++ll++   e  +lp+i+++  ge + + + ++ Ga 
   Pbr036239.1  19 VLVVDDDPTWLKILEKMLKKCSY-EVTTCGLAREALCLLREKKngYDIVISDVNMPDMDGFKLLEHVGLEM-DLPVIMMSVDGETSRVMKGVQHGAC 113
                   89*********************.***************999999**********************6644.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ ++el++
   Pbr036239.1 114 DYLLKPIRMKELRN 127
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363923.7E-1491595IPR017053Response regulator B-type, plant
SuperFamilySSF521728.25E-3516140IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23009.8E-4416146No hitNo description
SMARTSM004482.3E-3217129IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.45218133IPR001789Signal transduction response regulator, receiver domain
PfamPF000724.9E-2419128IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.52E-2920133No hitNo description
SuperFamilySSF466891.74E-16197255IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-27197256IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-21199252IPR006447Myb domain, plants
PfamPF002496.9E-8201251IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009735Biological Processresponse to cytokinin
GO:0010082Biological Processregulation of root meristem growth
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
MDSSFSSPRN DSFPAGLRVL VVDDDPTWLK ILEKMLKKCS YEVTTCGLAR EALCLLREKK  60
NGYDIVISDV NMPDMDGFKL LEHVGLEMDL PVIMMSVDGE TSRVMKGVQH GACDYLLKPI  120
RMKELRNIWQ HVFRKKIHEI KDIESHESVE GIQLMRSGSD QYDEGYFLGA DDLTSSRKRK  180
DVDNKYDDKD FADCSSTKKA RVVWSVDLHQ KFVKAVHQIG FDKVGPKKIL DLMNVPWLTR  240
ENVASHLQKY RLYLGRLQKE NDLKSCFGGM KHSDSPSKDA QGSFGLQNSI SIQQNDFAHG  300
SFRVSGNNLV AQCVDPKSHE GDAKGIVSEP VAEIKKGSNG NTPDSQRTRS LQMVDFNNSC  360
VEPKNGVIGN VPDSQKIRSS PLDFNNSYAE TKKVLNGNIP DSQKIRTPQV RPSHSFTSVE  420
SEVNFTEFES TIRTKYSWNE IQLKKEQKPL IQLNSGFNKP PLPGPHSHFQ GDRLQSIPSI  480
SPRPSIAEGD VTGPAKSKPS YSEYINNQGS HVSPTISTAD SFPDQIKSCV VNHQVSESIS  540
TSTSNMKNQG FNLSSITDLE SAQRNLIVGS ASPFASLDDD FQICWFQGDC YGMNLGLQNI  600
EFPEYNDPAL ISEVPAHLYD ALRFDYPCDV THQNILS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-17195257163ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00010PBMTransfer from AT1G67710Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr036239.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009359281.10.0PREDICTED: two-component response regulator ARR11 isoform X1
TrEMBLA0A498HPI30.0A0A498HPI3_MALDO; Two-component response regulator
STRINGXP_009359281.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39993360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.11e-128response regulator 11