PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr036117.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family LBD
Protein Properties Length: 380aa    MW: 43224.6 Da    PI: 6.3361
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr036117.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.92.2e-40741741101
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCaaCk++rrkC ++C+lapyfp +qpk f+n+hklFG+sn+lk+lk+l++ ++ +am+s++y+A++r + PvyG+ +vi++lq q+  +++el++++
  Pbr036117.1  74 ACAACKYQRRKCRAECPLAPYFPPDQPKMFQNAHKLFGVSNILKILKNLEPRQKLEAMRSIIYQANVRDKFPVYGCWEVIWQLQYQILVAEEELQAVH 171
                  7************************************************************************************************9 PP

       DUF260  99 eel 101
                  ++l
  Pbr036117.1 172 QQL 174
                  986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.07673174IPR004883Lateral organ boundaries, LOB
PfamPF031955.4E-3874171IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MFPISPLPFL LPLLLLQLTA TLLLLLLLIL FNLSHCITLL SNCFRGFSPF RLSDWFQSHF  60
GIQKMTLKGT TSQACAACKY QRRKCRAECP LAPYFPPDQP KMFQNAHKLF GVSNILKILK  120
NLEPRQKLEA MRSIIYQANV RDKFPVYGCW EVIWQLQYQI LVAEEELQAV HQQLAVYRQH  180
HQHQHQHQIL SVPEYVTSHL ELGMAPPNNP LPLFNHNPPP YNHNNNNNAT TVAPIDQHQQ  240
QSYSNSSDAA YSSAAYNIDS KDNIINNNTN NNNNDAGNQM WISNPFMTNN SNNNNNNSEA  300
IQSELGVLQP LSIQPEVVQD YDELHPFFDT IDDRQSYIDS KEAYDSSSEE SFKDTTRSME  360
HAENALKNAA ACFSLTSVN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-287517712114LOB family transfactor Ramosa2.1
5ly0_B2e-287517712114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr036117.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018500047.10.0PREDICTED: LOB domain-containing protein 27-like
SwissprotQ9STS62e-61LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A498HZI10.0A0A498HZI1_MALDO; Uncharacterized protein
STRINGXP_009343462.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.14e-49LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]