PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr034723.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family ARR-B
Protein Properties Length: 573aa    MW: 64033.2 Da    PI: 6.9552
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr034723.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like84.98.4e-27316370156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k +++WtpeLH++Fv+a+eqL G ++A+P++il+lmk +gLt+++v+SHLQkYR++
  Pbr034723.1 316 KMKVDWTPELHKKFVKAIEQL-GVDQAIPSRILDLMKTEGLTRHNVASHLQKYRMH 370
                  5689*****************.********************************96 PP

2Response_reg33.62.1e-12201261109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTT.SEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTE CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempg.mdGlellkeireeepklpiivvtahgeeedalealkaGa 94 
                   vl+ d + + ++ +r+ le  +y +v+++ + +eal  +  +   +++ ++ ++  +   G+++l++ +e    lpii+ +     +++ +++ +Ga
   Pbr034723.1  20 VLLLDGDTTSASQIRSNLEAMDY-IVTAFCNETEALSAFSSNPesFHVAIIEVNANNgHWGFQFLETAKE----LPIIMTSNIHCLSTMMKCIALGA 111
                   78889999999************.***************777777**********99899**99998766....77888887777************ PP

                   SEEEESS--HHHHHH CS
  Response_reg  95 kdflsKpfdpeelvk 109
                    +fl Kp+++++l++
   Pbr034723.1 112 VEFLLKPVSEDKLRN 126
                   ************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23002.2E-1716159No hitNo description
SuperFamilySSF521723.56E-1716134IPR011006CheY-like superfamily
SMARTSM004481.9E-518128IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011021.92419132IPR001789Signal transduction response regulator, receiver domain
PfamPF000726.9E-920127IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.33E-921131No hitNo description
PROSITE profilePS5129414.395313372IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.8E-26314372IPR009057Homeodomain-like
SuperFamilySSF466893.31E-17315373IPR009057Homeodomain-like
TIGRFAMsTIGR015577.9E-24316371IPR006447Myb domain, plants
PfamPF002499.0E-8319368IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
MVCTANDLQQ WNDFPKGLRV LLLDGDTTSA SQIRSNLEAM DYIVTAFCNE TEALSAFSSN  60
PESFHVAIIE VNANNGHWGF QFLETAKELP IIMTSNIHCL STMMKCIALG AVEFLLKPVS  120
EDKLRNIWQH VVHKAFNAGG SPISETLKPV KVSVVSMLQP KQENEEQNCK ISIETENVIR  180
VHENDQEQSA GSDKYPAPST PQIKQGSRLL DHGDCQYQIN CMSEKVSGEN DSESKSIETM  240
FCNPIDERNL HTREPHHMPR KTVIKEENDS GDGSKSEVNM SHHPDNIDSG NDNGGAAENL  300
SKASVPNTSC KSNRKKMKVD WTPELHKKFV KAIEQLGVDQ AIPSRILDLM KTEGLTRHNV  360
ASHLQKYRMH KRHILPKDED QRLLWPHRPP GARDPTHQTS YYPRSHRPIM AFPPYHYNNT  420
TLSMPPAYPM WGSQPPAGSH PATVQMWGQP GYPHSHWQYW NPYPGMQAEA WGCPVMPPKQ  480
GGYSSYPQNA SGFQSAGGHV VENGHRYSMP RNSFNIHLSE EVVDKVMKEA ISKPWLPLPL  540
GLKPPSTEGV LAELTRQGIC NIPQINGSHT QG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-16314369358ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr034723.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009342550.10.0PREDICTED: two-component response regulator-like APRR2
RefseqXP_009342551.10.0PREDICTED: two-component response regulator-like APRR2
RefseqXP_009342552.10.0PREDICTED: two-component response regulator-like APRR2
RefseqXP_009342553.10.0PREDICTED: two-component response regulator-like APRR2
SwissprotQ6LA431e-143APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLA0A498HIV60.0A0A498HIV6_MALDO; Uncharacterized protein
STRINGXP_009342550.10.0(Pyrus x bretschneideri)
STRINGXP_009342552.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35663465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-147ARR-B family protein
Publications ? help Back to Top
  1. Gong L, et al.
    Transcriptome Profiling of the Potato (Solanum tuberosum L.) Plant under Drought Stress and Water-Stimulus Conditions.
    PLoS ONE, 2015. 10(5): p. e0128041
    [PMID:26010543]