PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr034277.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family ARR-B
Protein Properties Length: 663aa    MW: 72789.5 Da    PI: 4.7435
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr034277.2genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like62.11.1e-19181224145
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtleh 45 
                  kpr++W+ eLH++Fv av+qL G +kA+Pk+il+lm+v+gLt+e+
  Pbr034277.2 181 KPRVVWSRELHQKFVAAVDQL-GYDKAVPKKILDLMNVEGLTREN 224
                  79*******************.********************986 PP

2Response_reg80.55.4e-27131211109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+ + ++ll+++l k +y +v+++ ++ +al++l+e++  +Dl++ D++mp+mdG++ll+ +  e  +lp+i+++++++++++ + ++ Ga 
   Pbr034277.2  13 VLAVDDNSTCLRLLEELLVKCQY-QVTTTNQAVKALQMLRENRnnFDLVISDVNMPDMDGFKLLELLGLEM-DLPVIMLSGYSDKDLVMKGISHGAC 107
                   799********************.***************999889*********************96644.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +eel +
   Pbr034277.2 108 DYLLKPVRIEELKN 121
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.3E-1311650IPR017053Response regulator B-type, plant
SuperFamilySSF521728.54E-3710136IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.2E-4210150No hitNo description
SMARTSM004481.4E-3311123IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.53312127IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.6E-2413121IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.22E-2814126No hitNo description
SuperFamilySSF466891.31E-11179232IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-19179224IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-16181224IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 663 aa     Download sequence    Send to blast
MTVEDRFPVG MRVLAVDDNS TCLRLLEELL VKCQYQVTTT NQAVKALQML RENRNNFDLV  60
ISDVNMPDMD GFKLLELLGL EMDLPVIMLS GYSDKDLVMK GISHGACDYL LKPVRIEELK  120
NIWQHVVRRK KFYPEDQNKS SSQDKGCLEA GEGGRAVSPS DEEEEDEEEE HENEELSYQK  180
KPRVVWSREL HQKFVAAVDQ LGYDKAVPKK ILDLMNVEGL TRENKFRQYL KKLRNPAFGV  240
RDSSYTRMAA LDGFGDAQSL VGSQRFSNAG LSPYIPSMML GRLNSTAGLS IRGTTSGLVQ  300
PGHSQNLSNY FNIPTKLQPV LPANQSPNVY QTIPASLEFK QSQQSKYITH IGESSPSNDS  360
TSYAIPSSFP GARASASSIF SDSNASSNPL ILHGTPQQTH GTGVVGNQSS LGVASLNPES  420
FDVGISSKFL DYNRCSDSWQ VAVQLSDFPM NALPMSEPGH HGQLHANNLG FASNGPQVAT  480
VPSDFSPSVL SAPAVELRGS ILNQEGLIGD VVPTMTCSPR QMWEEHKHDF NHNFNLSFNA  540
DNSMVSANVL LGPVGPSLDQ NDAVCSEKMT SSLFDILDGV TSPVMQPSEF QKSAMETTMN  600
PTEVYSWQQT KSPDDVAQNT YGPWNDVMTA ILKRGQNENV LSTDGDFGFD ACSPGSQQFI  660
PL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-19179233363ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the root-meristem size determination through the regulation of cell differentiation (PubMed:17363254). Involved in activating SHY2 during meristem growth and controls PIN expression via activation of SHY2 (PubMed:20605455). {ECO:0000250|UniProtKB:Q940D0, ECO:0000269|PubMed:17363254, ECO:0000269|PubMed:20605455}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr034277.2
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018503450.10.0PREDICTED: two-component response regulator ARR12-like isoform X1
SwissprotP625981e-107ARR12_ARATH; Two-component response regulator ARR12
TrEMBLA0A498HXI40.0A0A498HXI4_MALDO; Two-component response regulator
STRINGXP_009358481.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-91response regulator 12
Publications ? help Back to Top
  1. Takahashi N, et al.
    Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots.
    Curr. Biol., 2013. 23(18): p. 1812-7
    [PMID:24035544]
  2. Cortleven A, et al.
    A novel protective function for cytokinin in the light stress response is mediated by the Arabidopsis histidine kinase2 and Arabidopsis histidine kinase3 receptors.
    Plant Physiol., 2014. 164(3): p. 1470-83
    [PMID:24424319]
  3. Kim HJ,Kieber JJ,Schaller GE
    The rice F-box protein KISS ME DEADLY2 functions as a negative regulator of cytokinin signalling.
    Plant Signal Behav, 2013. 8(12): p. e26434
    [PMID:24675172]
  4. Choi SH, et al.
    Gene duplication of type-B ARR transcription factors systematically extends transcriptional regulatory structures in Arabidopsis.
    Sci Rep, 2014. 4: p. 7197
    [PMID:25425016]
  5. Jiang L, et al.
    Strigolactones spatially influence lateral root development through the cytokinin signaling network.
    J. Exp. Bot., 2016. 67(1): p. 379-89
    [PMID:26519957]
  6. Cortleven A, et al.
    Cytokinin Regulates the Etioplast-Chloroplast Transition through the Two-Component Signaling System and Activation of Chloroplast-Related Genes.
    Plant Physiol., 2016. 172(1): p. 464-78
    [PMID:27388681]
  7. Kobayashi K, et al.
    Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling.
    Plant Physiol., 2017. 173(4): p. 2340-2355
    [PMID:28193764]
  8. Zhang TQ, et al.
    A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration.
    Plant Cell, 2017. 29(5): p. 1073-1087
    [PMID:28389585]
  9. Meng WJ, et al.
    Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
    Plant Cell, 2017. 29(6): p. 1357-1372
    [PMID:28576846]
  10. Kobayashi K,Iwase A
    Simultaneous but spatially different regulation of non-photosynthetic callus formation and photosynthetic root development after shoot removal.
    Plant Signal Behav, 2017. 12(6): p. e1338999
    [PMID:28594268]
  11. Dai X, et al.
    ARR12 promotes de novo shoot regeneration in Arabidopsis thaliana via activation of WUSCHEL expression.
    J Integr Plant Biol, 2017. 59(10): p. 747-758
    [PMID:28681564]
  12. Zhang F,May A,Irish VF
    Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL.
    Trends Plant Sci., 2017. 22(10): p. 815-817
    [PMID:28886911]
  13. Yan Z, et al.
    Type B Response Regulators Act As Central Integrators in Transcriptional Control of the Auxin Biosynthesis Enzyme TAA1.
    Plant Physiol., 2017. 175(3): p. 1438-1454
    [PMID:28931628]
  14. Bustillo-AvendaƱo E, et al.
    Regulation of Hormonal Control, Cell Reprogramming, and Patterning during De Novo Root Organogenesis.
    Plant Physiol., 2018. 176(2): p. 1709-1727
    [PMID:29233938]