PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr032760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family ARR-B
Protein Properties Length: 416aa    MW: 46261.8 Da    PI: 8.5901
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr032760.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like78.67.9e-25210263155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kp+++Wt+ LH++F+ a++++ G +kA+Pk+ile+m+v+gLt+e+v+SHLQkYR+
  Pbr032760.1 210 KPKVVWTNSLHNQFLLAIRHI-GLDKAVPKRILEFMNVPGLTRENVASHLQKYRM 263
                  79*******************.********************************7 PP

2Response_reg80.55.6e-27261341109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   +l+vdD+ + + ++  +l+   y +v +++++ +al++l++++  +Dl+++D+ mp+mdG+el k+ r e  klp+i+++a ++e+ +l+ l+ G  
   Pbr032760.1  26 ILVVDDDATTLAIVSAMLKTWSY-QVVAVKNPMDALAILRAQKgaFDLVVTDLHMPQMDGFELHKHVRDEF-KLPVIMMSADDNENVILKSLEGGFA 120
                   89*********************.9999***********888888************************99.************************* PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+ +Kp++++++ +
   Pbr032760.1 121 DYMVKPVSKDDIKN 134
                   **********9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.14E-3422139IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23003.7E-3723147No hitNo description
SMARTSM004485.2E-3024136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.17625140IPR001789Signal transduction response regulator, receiver domain
PfamPF000728.3E-2426134IPR001789Signal transduction response regulator, receiver domain
CDDcd001569.26E-2927139No hitNo description
PROSITE profilePS512949.388207266IPR017930Myb domain
SuperFamilySSF466896.81E-19207267IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.7E-26208267IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-25210263IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MDATDSAEFR QSSSISKPSF VGMINILVVD DDATTLAIVS AMLKTWSYQV VAVKNPMDAL  60
AILRAQKGAF DLVVTDLHMP QMDGFELHKH VRDEFKLPVI MMSADDNENV ILKSLEGGFA  120
DYMVKPVSKD DIKNVWQYAE ADKKGKSVVI EEIEGAPREA PGEVDNGINS GMSSDTDEEQ  180
LEKKAEAKAK KAKKRDREGD NEERMVAPKK PKVVWTNSLH NQFLLAIRHI GLDKAVPKRI  240
LEFMNVPGLT RENVASHLQK YRMFLKRVAE KARLSKCLSE RVFRSSFAFA HPGPVFNSME  300
AGDQYSQYLK LQQQMGASPI NIASAFQLSS AGIDGNTTNL LGSIQYPNYQ QSSCSSNTMR  360
SMPQLIGSGQ SRLLKHITQA NLLRHQPWLG NVNHQLISQA YRFGPFPSAE PYHSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-22207269264ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr032760.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009341303.10.0PREDICTED: two-component response regulator ARR2-like
TrEMBLA0A498KU080.0A0A498KU08_MALDO; Uncharacterized protein
STRINGXP_009341303.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101422534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.18e-67response regulator 2