PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr032759.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family LBD
Protein Properties Length: 468aa    MW: 50744.6 Da    PI: 4.409
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr032759.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260110.21.5e-343184153100
       DUF260   3 aaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                  a Ck+lrr+C++dCv++pyfp ++p++fa vh+++Gasnv k+l++lp++ r +a+++l+yeAe+r++d vyG+v++i++l++++++++ +la++++e
  Pbr032759.1 318 ATCKYLRRRCPSDCVFSPYFPPNNPQRFASVHRIYGASNVAKMLQQLPDHLRAEAADTLCYEAECRIQDLVYGCVKTISQLHHEIHNAECQLAKTRAE 415
                  78*******************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.157315416IPR004883Lateral organ boundaries, LOB
PfamPF031956.7E-36318413IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MNNFGSSGGM SSNAANTTGL TTNNIITNNL IQIFQQARQH GIFTNNNPFS YNFGTPGIQN  60
NVTNQQLIGN FSGTQMMSPN GRSELLGILN NFNGTGGFSS NGFNFNNETI NGLTNRVRNV  120
SLSGTTPPMA TLGGSSSLSP SAGIGTSTTT SSAYQFRKDF SNNREDQQQN VSVLPPPAEN  180
TDDNSTTTPT LVNKNNLSPG QEMDKALDDL MISNLFVDQQ NNYQPPPSSQ QQGGDQDQLP  240
PDFSSFLYPV EVPDATPNQM NPAVADQGLD TAVNKVSDPS PDQQQGGDQQ VLNPEFSGNV  300
FESEDYNMLF QTALPFPATC KYLRRRCPSD CVFSPYFPPN NPQRFASVHR IYGASNVAKM  360
LQQLPDHLRA EAADTLCYEA ECRIQDLVYG CVKTISQLHH EIHNAECQLA KTRAEIAFIN  420
SGGGGGGGQE HQVHQTQEVQ SDLSFFPDQT EVEATLFGSS SKATWFI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-3331842613121LOB family transfactor Ramosa2.1
5ly0_B9e-3331842613121LOB family transfactor Ramosa2.1
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00381DAPTransfer from AT3G26620Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr032759.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017181693.10.0putative two-component response regulator ARR13
TrEMBLA0A498KU080.0A0A498KU08_MALDO; Uncharacterized protein
STRINGXP_008378185.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.17e-47LOB domain-containing protein 24