PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr032195.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family M-type_MADS
Protein Properties Length: 355aa    MW: 40724.4 Da    PI: 8.8132
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr032195.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF64.51.1e-20444343
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                 i n++ r++tf kRr+gi+KKA+E S+LC+++v++ii++++
  Pbr032195.1  4 IANERSRKTTFQKRRKGIMKKAYEFSTLCEVDVCMIIYGPK 44
                 89*************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.526144IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-12151IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.49E-19191IPR002100Transcription factor, MADS-box
CDDcd002664.31E-22172No hitNo description
PfamPF003192.4E-19443IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MELIANERSR KTTFQKRRKG IMKKAYEFST LCEVDVCMII YGPKLTDRPP ELQTWPKNPE  60
EVSRIINKYK ASTMCKPAKK TFDLSDLLMD RKNKVYADIY RKRKEMYETK YPAWDERINT  120
FSESQLEALL NALDAKLESG KRILLNRKKE AAGHQILVMK KEAPTLLMGG KPDVGESSSR  180
KHPCNYEEDQ NHMSSFSNNM VDHMLQQFPH QPYDQMLQFD NSNENLSNLL APNPGPTAMW  240
MLRESNCSLQ FSAGASGSNS QFPVAGNQGN FSDPMMIHST VENTNMNMLM VNNNLNPPRS  300
SYMSQQYYAR LMQPAVPYMQ YPVMPASISS HPVQLRASQA KDDQYQDVNH YLWS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr032195.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009341327.10.0PREDICTED: agamous-like MADS-box protein AGL82
TrEMBLA0A498HFG80.0A0A498HFG8_MALDO; Uncharacterized protein
STRINGXP_009341327.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58890.12e-23AGAMOUS-like 82