PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr029987.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family SBP
Protein Properties Length: 518aa    MW: 57650.1 Da    PI: 7.7996
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr029987.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP125.81.7e-39161237177
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  +Cqv+gC++dl+  k+yh+rh+vC+ hsk++ v+v+g+eqrfCqqCsrfh l efD  krsCrrrLa+hn rrrk+q
  Pbr029987.1 161 TCQVHGCNMDLTFSKDYHKRHRVCDPHSKTAIVIVNGIEQRFCQQCSRFHLLAEFDAVKRSCRRRLAGHNLRRRKPQ 237
                  6**************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.6E-31158223IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.513159236IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.76E-37160241IPR004333Transcription factor, SBP-box
PfamPF031103.0E-30162235IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
MESWSFGSEG KGFLFTEEMD MPTDAFSRST RKALLELDNK TCFNFGKESV DSMGFMDLGF  60
PDINQGVEIL NGVMGNGSSY NSVASPCCLI SSSSSFGDGE SGSKFSSPMT ESNSMDSSMI  120
ALKLGGFADS RGGQNSQHSI SRERSKRAGN GMRSSYYHAP TCQVHGCNMD LTFSKDYHKR  180
HRVCDPHSKT AIVIVNGIEQ RFCQQCSRFH LLAEFDAVKR SCRRRLAGHN LRRRKPQLDT  240
LDCKPHKLIR SCEGNGYMGT SFSKGTPFVF SDILPDGCIQ YPEYEEANLY GRVKSEDRST  300
YGQSVTPIPN RQFIPKSFCH LPGLGEQHAL GSPSSGNVYS VFDTASTAEK AFETAYSSCA  360
HSLLSAQSHN LSSNSAGVQV PSPLTNQSAH RSFGQLNEKT SRVNSMENCG RNRSYPFSMK  420
SMGADHMESI KISDSRYAAD FQLHTDRALH VSDCLSDKYC VSPERTFDLR QLSSHLQRVE  480
HERDFFQVAG GWRQFGSSAE FQHFHTEAGR NFRYHWQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-261622351184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr029987.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009356437.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_009356438.10.0PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLA0A498IE390.0A0A498IE39_MALDO; Uncharacterized protein
STRINGXP_009356437.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-34SBP family protein