PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr029429.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GATA
Protein Properties Length: 384aa    MW: 41877.1 Da    PI: 6.271
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr029429.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.15.6e-19299333135
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                  Cs+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  Pbr029429.1 299 CSHCGVQKTPQWRTGPNGAKTLCNACGVRYKSGRL 333
                  *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.8E-17293347IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.426293329IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.85E-14294355No hitNo description
Gene3DG3DSA:3.30.50.103.7E-15297331IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.84E-15298346No hitNo description
PROSITE patternPS003440299324IPR000679Zinc finger, GATA-type
PfamPF003206.0E-17299333IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MLYQTHPLFI PISSLFSLLV QFFLQPQALS SLSLSSSSAL LLPPLPPQQV GTEMECVEVA  60
LKTSIRKEMA LKATGPQVVV FDDLWGGAVV NGQNACDDFS VDDLLDFSNE DGFVETEAEE  120
EGDKEKVKGF VSVSPQKQNQ ETEKSNLSEK IEPASELSVP ADDLDNLEWL SHFVEDSFSE  180
FSTALPAGFL PEKPKSEKRP DLETPFPEKP CFKTPVPAKA RSKRSRTGGR VWSLGSPSLT  240
ESSSSSSSSS SSSPSSPWTI YPATQNQESA EPVLSVEKPP RKQKRRLVDG SSSQPPRRCS  300
HCGVQKTPQW RTGPNGAKTL CNACGVRYKS GRLLPEYRPA CSPTFSSELH SNHHRKVIEM  360
RRKKEGPGTP EPGMTIAPAV PGF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009338657.10.0PREDICTED: GATA transcription factor 5-like
SwissprotQ9FH577e-86GATA5_ARATH; GATA transcription factor 5
TrEMBLD9ZIZ10.0D9ZIZ1_MALDO; GATA domain class transcription factor
STRINGVIT_04s0023g02880.t011e-107(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.25e-79GATA transcription factor 5