PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr029255.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family HD-ZIP
Protein Properties Length: 304aa    MW: 34212.3 Da    PI: 7.1993
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr029255.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.94e-19145199256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ ++tkeq  +Le+ F+++ +++ ++++eLA+kl+L  rqV vWFqNrRa+ k
  Pbr029255.1 145 RKKLRLTKEQSATLEDTFREHTTLNPKQKQELARKLNLRPRQVEVWFQNRRARTK 199
                  78889************************************************98 PP

2HD-ZIP_I/II119.81.4e-38145232188
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                  +kk+rl+keq+++LE++F+e+++L+p++K+elar+L+l+prqv+vWFqnrRARtk+kq+E ++e Lk+++++lkeen+rL+ke +eL+
  Pbr029255.1 145 RKKLRLTKEQSATLEDTFREHTTLNPKQKQELARKLNLRPRQVEVWFQNRRARTKLKQTEAECELLKQCCETLKEENRRLHKELQELK 232
                  69*************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.6E-18130199IPR009057Homeodomain-like
SuperFamilySSF466897.1E-19134202IPR009057Homeodomain-like
PROSITE profilePS5007117.767141201IPR001356Homeobox domain
SMARTSM003897.1E-17143205IPR001356Homeobox domain
CDDcd000861.11E-16144202No hitNo description
PfamPF000461.3E-16145199IPR001356Homeobox domain
PROSITE patternPS000270176199IPR017970Homeobox, conserved site
PfamPF021831.2E-7201235IPR003106Leucine zipper, homeobox-associated
SMARTSM003409.3E-16201244IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MGFDHEACNT GLGLSLGCQG NPDHRTNLQA FDLDHQKKKK IQLKYDHLLP ALTLGPSSGA  60
KIEAAKSDDH LHQVVYVQAQ EQASSPCSGA VSSFSNSSSF KRDRGLGVEE IEGEVEEERV  120
VNITTSSRVS DELYDQDQDH EGSPRKKLRL TKEQSATLED TFREHTTLNP KQKQELARKL  180
NLRPRQVEVW FQNRRARTKL KQTEAECELL KQCCETLKEE NRRLHKELQE LKLMKQTATA  240
AAPFYMQFPT ATLTMCPSCE KICNVGDHHN HNHNESSTSP FLVGSNKTHL IFNPYSTHPS  300
TAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1193201RRARTKLKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr029255.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009337132.10.0PREDICTED: homeobox-leucine zipper protein HAT22-like
TrEMBLA0A498J7S00.0A0A498J7S0_MALDO; Uncharacterized protein
STRINGXP_009337132.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-66HD-ZIP family protein