PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr028877.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family Trihelix
Protein Properties Length: 224aa    MW: 26525.1 Da    PI: 9.7049
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr028877.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix57.53.6e-182622386
     trihelix 23 rgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86
                 ++k++k lWe +s km+e+g +rs++qCk+kw+nl +ryk ++++e +     ++++p++++l+
  Pbr028877.1  2 ETKRNKLLWEVISTKMKEKGHHRSAEQCKCKWKNLVTRYKGCETMEPEA---MRQQFPFYNELQ 62
                 56889******************************************95...56689*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138373.0E-15364No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
METKRNKLLW EVISTKMKEK GHHRSAEQCK CKWKNLVTRY KGCETMEPEA MRQQFPFYNE  60
LQAIFAARIQ RMLWAEESGA ASGSKKKTLS SDDEEDNEDS EAENKGSTAR NKKKKVKMSN  120
IGSSGTSGSA SGNNVREILE GFMKQQMQME MQWREEFQAR ENERRLKEME WRQRMEALEN  180
ERIMMETRWR EREEQRRLRE EARAEKRDAL ITALLSKLRR EDM*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009338172.11e-162PREDICTED: trihelix transcription factor GT-3b-like
RefseqXP_009338169.11e-162PREDICTED: trihelix transcription factor GT-3b-like
SwissprotQ9SDW06e-60TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLA0A103YLU93e-95A0A103YLU9_CYNCS; Myb-like domain-containing protein
STRINGPOPTR_0006s10240.13e-89(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.14e-42Trihelix family protein