PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr028774.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family ARR-B
Protein Properties Length: 628aa    MW: 70556 Da    PI: 7.68
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr028774.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like66.44.8e-21247298355
      G2-like   3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  r  WtpeLH +F  a++ L G ++A Pk+il+ m+v+ +tl +v+SHLQkYR 
  Pbr028774.1 247 RTIWTPELHLKFTAALRAL-GYQNARPKSILKWMNVPNITLRQVASHLQKYRK 298
                  889****************.9*******************************6 PP

2Response_reg50.61e-17211271109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   +l+vd + l ++  ++ l+k  + +v++++ ++ al +++e++  +Dl++  i+mp+ +G+ +l+ +++   k+p+i+++ + + + a++al  Ga 
   Pbr028774.1  21 ILVVDHDTLPLMSTASRLKKYSF-KVTTTALASVALSMIREQKdhYDLVMANISMPDKHGFSFLRVLHK---KIPVIFMSLEVNINVAKKALAEGAC 113
                   89*********************.***************777777**********************99...68*********************** PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                    fl Kp++ e+l +
   Pbr028774.1 114 FFLQKPISLEDLKN 127
                   ***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521726.12E-2317141IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23003.3E-2518155No hitNo description
SMARTSM004484.4E-1419129IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011031.28420133IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.7E-1521127IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.03E-1622132No hitNo description
Gene3DG3DSA:1.10.10.603.9E-22243302IPR009057Homeodomain-like
SuperFamilySSF466892.06E-16244301IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-18247299IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 628 aa     Download sequence    Send to blast
MEHMSPKETN GLPSFARDLR ILVVDHDTLP LMSTASRLKK YSFKVTTTAL ASVALSMIRE  60
QKDHYDLVMA NISMPDKHGF SFLRVLHKKI PVIFMSLEVN INVAKKALAE GACFFLQKPI  120
SLEDLKNVWQ HVYRKVRNPR KDTHKPNCAK KIDEAGNVLR LPTGGKVRRG EGNRQRELQC  180
SRAEQQIATE NHTKGAFGIK RPVDDKEEQE KAKKVRLNIE LSGSTNKDEE GKENKDCNGS  240
SEDRRCRTIW TPELHLKFTA ALRALGYQNA RPKSILKWMN VPNITLRQVA SHLQKYRKQV  300
QEIQEAGTTS LPSLSRPYSW NSRNEFPPAR KTSLICRPYE QGTSTFGVQG NPVQLMTPNS  360
FTRFSDYRRQ NPYSEHTVMS HNANHQSESL YDFYLRTHGK FQNLDQIIET NGFTLGAGMN  420
EIEKRNHPLG LEESRFQVSE TTLPSTNYMT PGFTSPYISA NTFQLPNAST SMNQAQFYTP  480
APTTSINSHN QNHFFAEITG TTEVGINQAH YYTPTPTSPI NFQNQNHFSA EVTGTTEVLE  540
VGPEHIASGN AANAETFPAD FNGGSQQLDA AAREASPGSS NNNQPMLEYD DLLKLLEEDP  600
EEFNWCDSAP NAGDANGYCE LLTETSK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr028774.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018502937.10.0PREDICTED: putative two-component response regulator ARR19
TrEMBLA0A498HIR00.0A0A498HIR0_MALDO; Uncharacterized protein
STRINGEMJ260480.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144041618
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68210.13e-43pseudo-response regulator 6