PlantRegMap
Plant Transcription Factor Database
PlantTFDB
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr026275.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family LBD
Protein Properties Length: 303aa    MW: 33436.4 Da    PI: 6.1134
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr026275.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260120.59.4e-38101091100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCaaCk++rrkCakdC+lap+fpa+qp  f+n+h+l+G+sn++k+lk++++e+ e+am+s++ye+++ra+  v G++g+i++l+ ql+q+ +el +++
  Pbr026275.1  10 ACAACKYHRRKCAKDCALAPHFPADQPMMFQNAHRLYGVSNIMKILKKVHPEQEEEAMTSIIYESNMRAKFSVTGCMGIINQLNFQLQQALEELRYVR 107
                  7*********************************************************************************************9998 PP

       DUF260  99 ee 100
                  ++
  Pbr026275.1 108 TH 109
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.489110IPR004883Lateral organ boundaries, LOB
PfamPF031954.2E-3610107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MTIKGGTSQA CAACKYHRRK CAKDCALAPH FPADQPMMFQ NAHRLYGVSN IMKILKKVHP  60
EQEEEAMTSI IYESNMRAKF SVTGCMGIIN QLNFQLQQAL EELRYVRTHL AICKDQCQYR  120
LPSSSPHYSS PSPQLQLGIP TNTDAATLTL YQQHQYPYQY ASGASGASGA SGASGGMSWV  180
GNEYLANGLN GVYIDDNDNM VKTLRVQHPY YNDNNVEQLM AVQSSLVSSQ AFPVHQEMDV  240
PHDYDDIPFD TIADDRQSYI ESKEGCESSA ESSFKATTQS IEHVSQNDLK SAAACFSLTS  300
VK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-2561107111LOB family transfactor Ramosa2.1
5ly0_B2e-2561107111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr026275.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009335812.20.0PREDICTED: LOB domain-containing protein 6-like
TrEMBLA0A498J2U51e-179A0A498J2U5_MALDO; Uncharacterized protein
STRINGXP_009335812.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.14e-40LOB domain-containing protein 27