PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr024283.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family HD-ZIP
Protein Properties Length: 290aa    MW: 32115.1 Da    PI: 8.0119
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr024283.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.45.8e-19144198256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ ++tkeq   Lee F+++++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  Pbr024283.1 144 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTK 198
                  78889************************************************98 PP

2HD-ZIP_I/II124.45.4e-40144233191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rl+keq++lLEesF+++++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke  eL+ +l
  Pbr024283.1 144 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLQKELIELK-AL 233
                  69************************************************************************************99.44 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.4E-18130194IPR009057Homeodomain-like
SuperFamilySSF466893.97E-19133201IPR009057Homeodomain-like
PROSITE profilePS5007117.734140200IPR001356Homeobox domain
SMARTSM003892.3E-16142204IPR001356Homeobox domain
CDDcd000861.22E-17143201No hitNo description
PfamPF000462.2E-16144198IPR001356Homeobox domain
PROSITE patternPS000270175198IPR017970Homeobox, conserved site
SMARTSM003409.2E-25200243IPR003106Leucine zipper, homeobox-associated
PfamPF021839.2E-10200234IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MGFDDHACNT GLVLGLCLTS SASQESSNPT KFAKNNIKPS LNSAPTSGDF EPSLTLGLFG  60
EPYHQQMIAS NIYKVGNSSQ EETVDLYRQA AAASSPHSHS AVSNSFSSGR VVKRERDISS  120
EEVEVDEKVS SRVSDEDEDG SNPRKKLRLT KEQSALLEES FKQHSTLNPK QKQALARQLN  180
LRPRQVEVWF QNRRARTKLK QTEVDCEFLK KCCETLTDEN RRLQKELIEL KALKLSQPLY  240
MHMPAATLTM CPSCERIGGV GSEGSSKSPF SMAPKPHFYN HFTNPSAAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1192200RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr024283.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009354594.10.0PREDICTED: homeobox-leucine zipper protein HAT22-like
RefseqXP_009354595.10.0PREDICTED: homeobox-leucine zipper protein HAT22-like
SwissprotP466045e-97HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A498HXZ70.0A0A498HXZ7_MALDO; Uncharacterized protein
STRINGXP_009354594.10.0(Pyrus x bretschneideri)
STRINGXP_009354595.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22800.11e-84HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]