PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr024084.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family LBD
Protein Properties Length: 106aa    MW: 11897.3 Da    PI: 4.3267
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr024084.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26044.64.1e-1415546100
       DUF260  46 lkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                  +++lp + re+a++s++yeA  r++dPvyG+v++i++lq+++ ++++e+ +++ +
  Pbr024084.1   1 MQQLPVHLREAAADSMFYEASLRVEDPVYGCVRIISQLQHHILEVQSEILKTNGQ 55 
                  689999*****************************************99887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089110.467156IPR004883Lateral organ boundaries, LOB
PfamPF031959.3E-13151IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 106 aa     Download sequence    Send to blast
MQQLPVHLRE AAADSMFYEA SLRVEDPVYG CVRIISQLQH HILEVQSEIL KTNGQIASYI  60
AQQQLQQQQQ NVVDGASYQQ DMQICEYLGV GSDVQTLAND SYFHP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr024084.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009333972.17e-70PREDICTED: LOB domain-containing protein 24-like
TrEMBLA0A498HEA64e-43A0A498HEA6_MALDO; Uncharacterized protein
STRINGXP_009333972.13e-69(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.15e-14LOB domain-containing protein 24