PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr022786.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family DBB
Protein Properties Length: 380aa    MW: 41194.8 Da    PI: 5.5859
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr022786.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.52.4e-071458240
     zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                 ++r+C+ ++   + l+C+ ++  lC +C  e H+       Ht++
  Pbr022786.1 14 RKRVCDYCGTSMALLYCRADSAKLCFSCDREVHSAnqlftkHTRS 58
                 5789******99*********************667888888875 PP

2zf-B_box28.43.3e-095990435
     zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHk 35
                   C+ +++ ++++fC++ ++ lC++C  e+H+
  Pbr022786.1 59 LLCDACDKSPASIFCTTEGSVLCQNCDWESHN 90
                 57***************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.6E-151360IPR000315B-box-type zinc finger
PROSITE profilePS5011910.8361360IPR000315B-box-type zinc finger
PfamPF006436.3E-71458IPR000315B-box-type zinc finger
CDDcd000217.11E-71660No hitNo description
PROSITE profilePS5011910.0456106IPR000315B-box-type zinc finger
CDDcd000212.39E-56089No hitNo description
PfamPF006433.2E-760100IPR000315B-box-type zinc finger
SMARTSM003360.7561106IPR000315B-box-type zinc finger
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MNGGTRNEEP GATRKRVCDY CGTSMALLYC RADSAKLCFS CDREVHSANQ LFTKHTRSLL  60
CDACDKSPAS IFCTTEGSVL CQNCDWESHN ISSSTVAAAG HARGALEGFS GCPCLSELLA  120
VVGFENMDKK TLLLSDEDGG GRGGGGGGGF LGCGVDGFSD LEDGFSDFLV WDTPSVVSLD  180
DLIVSNPAYK FQAMGVPPLP KNRNAACGQH KEEIIHQLRV LVKSEPDLFS EDVDVKSRKG  240
FQSLASEPNT QPASFFTGFG HDAEPTAFPA QEAHESQYNG FKAENHDSCL KTSMRSYLQD  300
CFVVPDKHLY NDGTGSRDNE GHGGQKNSKA SSGFPKVVPH EISCQNRETA LSRYKEKKKT  360
RRYYIPISTQ VSFSELEID*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139147GGRGGGGGG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009378903.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 13
TrEMBLM5VM630.0M5VM63_PRUPE; Uncharacterized protein
STRINGVIT_07s0104g01360.t011e-104(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70553145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47890.22e-69B-box type zinc finger protein with CCT domain