PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr021767.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family TALE
Protein Properties Length: 144aa    MW: 16906.1 Da    PI: 9.6029
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr021767.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.49.8e-08921252154
                  HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  k +yp+++++++L +++gL+ +q+ +WF N+R +
  Pbr021767.1  92 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 125
                  469*****************************87 PP

2ELK26.91.1e-094667122
          ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                 ELK +L++++++++ ++++E++
  Pbr021767.1 46 ELKIELKQGFKSRIEDVREEIL 67
                 9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512139.1324666IPR005539ELK domain
PROSITE profilePS5007111.67766129IPR001356Homeobox domain
SuperFamilySSF466898.55E-1768133IPR009057Homeodomain-like
SMARTSM003891.4E-1068133IPR001356Homeobox domain
CDDcd000861.21E-1069130No hitNo description
Gene3DG3DSA:1.10.10.601.6E-2573131IPR009057Homeodomain-like
PfamPF059203.0E-1886125IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MSDDEDDMPM DFTMDQSGGE GHDMMGFGPL LPTESERSLM ERVRQELKIE LKQGFKSRIE  60
DVREEILRKR RAGKLPGDTT TVLKNWWQQH SKWPYPTEDD KAKLVEETGL QLKQINNWFI  120
NQRKRNWHSN SQSVTSLKSK RKR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A6e-1469125864Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122142RKRNWHSNSQSVTSLKSKRKR
Functional Description ? help Back to Top
Source Description
UniProtMay be involved in secondary cell wall biosynthesis. {ECO:0000269|PubMed:15980264}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr021767.1
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ0381321e-165JQ038132.1 Prunus persica cultivar Chiripa KNOPE7 (KNOPE7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009377898.11e-103PREDICTED: homeobox protein HD1-like
RefseqXP_009377901.11e-103PREDICTED: homeobox protein HD1-like
SwissprotQ9FPQ89e-92KNAT7_ARATH; Homeobox protein knotted-1-like 7
TrEMBLD9ZJ071e-100D9ZJ07_MALDO; HD domain class transcription factor
STRINGXP_009377898.11e-102(Pyrus x bretschneideri)
STRINGXP_009377901.11e-102(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF63483450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.14e-94KNOTTED-like homeobox of Arabidopsis thaliana 7
Publications ? help Back to Top
  1. Srinivasasainagendra V,Page GP,Mehta T,Coulibaly I,Loraine AE
    CressExpress: a tool for large-scale mining of expression data from Arabidopsis.
    Plant Physiol., 2008. 147(3): p. 1004-16
    [PMID:18467456]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. He JB, et al.
    KNAT7 positively regulates xylan biosynthesis by directly activating IRX9 expression in Arabidopsis.
    J Integr Plant Biol, 2018. 60(6): p. 514-528
    [PMID:29393579]