PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr021563.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB_related
Protein Properties Length: 325aa    MW: 35460.1 Da    PI: 8.1172
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr021563.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding378e-1260104147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +W++ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
      Pbr021563.1  60 RESWSEPEHDKFLEALQLFDRD-WKKIEAFIG-SKTVIQIRSHAQKY 104
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.17E-1554110IPR009057Homeodomain-like
PROSITE profilePS5129413.31555109IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-558110IPR009057Homeodomain-like
TIGRFAMsTIGR015578.4E-1858107IPR006447Myb domain, plants
SMARTSM007172.0E-959107IPR001005SANT/Myb domain
PfamPF002491.4E-960104IPR001005SANT/Myb domain
CDDcd001672.86E-762105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MLSKNPNLPE GLYLDPDVNG MALPGLGPFA PVTATASTTS SSAEDLSKKI RKPYTITKSR  60
ESWSEPEHDK FLEALQLFDR DWKKIEAFIG SKTVIQIRSH AQKYFLKVQK NGTSEHLPPP  120
RPKRKAAHPY PQKASKNALA LPPVSGSCLS SSALLESGFN QRPDSSSMLM SPIPGPVAPS  180
WTNGSVQSAN PSHESKGVLE PATVPNNSCS TTESTLKAQP VGGTTDQVKH SHALRVLPDF  240
TQVYGFIGSV FDPNVIGHMQ NLKKMDPIDV ETVLLLMRNL SMNLTNPDFE DHRQLLSSYK  300
MDADTGNLSD ETKSRCDNQH EKVA*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr021563.1
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744760.0DQ074476.1 Malus x domestica MYBR5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009377597.10.0PREDICTED: protein REVEILLE 6-like isoform X1
SwissprotQ8H0W31e-114RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A498KRN20.0A0A498KRN2_MALDO; Uncharacterized protein
STRINGXP_009377597.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.11e-100MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]