PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr020833.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family WOX
Protein Properties Length: 231aa    MW: 26040.3 Da    PI: 8.7474
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr020833.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox47.53.1e-152491557
                 HHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox 15 LeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 Le+++++  r+psae++++++++l    +++ ++V++WFqN++a++++
  Pbr020833.1  2 LENFYKQgVRTPSAEQIQQITSRLkafgHIEGKNVFYWFQNHKARQRQ 49
                 99****99**************************************97 PP

2Wus_type_Homeobox87.31.7e-281511565
  Wus_type_Homeobox 15 iLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +Le+ yk+G+rtP++e+iq+it++L+++G+ie+kNVfyWFQN+kaR+rqkq
        Pbr020833.1  1 MLENFYKQGVRTPSAEQIQQITSRLKAFGHIEGKNVFYWFQNHKARQRQKQ 51
                       69***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.625150IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.6E-5149IPR009057Homeodomain-like
SuperFamilySSF466891.27E-8153IPR009057Homeodomain-like
PfamPF000466.1E-13249IPR001356Homeobox domain
CDDcd000866.64E-4251No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MLENFYKQGV RTPSAEQIQQ ITSRLKAFGH IEGKNVFYWF QNHKARQRQK QKQESIAYNR  60
LLHRRTTQPI FLPPYDLNPP CPNVMCSPYY VPVHSELGFY PQSPYPNKVP LPGVPNVVKR  120
RPRAEKLEKR RTTCTTGGAG YEPMHPHNGY NTSGGSDMVN DATSKLISKC DQQTLPLFPL  180
QPTGILQQGR EDQNYPCTVN DADCSSAALI DSSADQIVGD QQPFYDFFSG *
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr020833.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009353812.11e-174PREDICTED: WUSCHEL-related homeobox 2
TrEMBLA0A498IMG31e-163A0A498IMG3_MALDO; Uncharacterized protein
STRINGXP_009353812.11e-173(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.11e-45WUSCHEL related homeobox 2