PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr020210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family bZIP
Protein Properties Length: 155aa    MW: 17698.9 Da    PI: 8.9498
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr020210.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.53.4e-1452110563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  ++ +r+++NR +ArrsR RKk++ieeL   v++L + N++L ++l +l +  ++  +e+
  Pbr020210.1  52 RKLKRMISNRKSARRSRMRKKKQIEELHYQVDQLHSTNRQLSEKLIQLLEGNQQILQEN 110
                  5789********************************************99999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.4E-1145112IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.23150113IPR004827Basic-leucine zipper domain
PfamPF001701.1E-1252110IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.74E-1152103No hitNo description
Gene3DG3DSA:1.20.5.1709.6E-1252108No hitNo description
CDDcd147021.63E-1453101No hitNo description
PROSITE patternPS0003605570IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MELNESMPIY PTRFFPISHI HVPNPDFSAN TSSLGNEAAF DEAGQQDMNY KRKLKRMISN  60
RKSARRSRMR KKKQIEELHY QVDQLHSTNR QLSEKLIQLL EGNQQILQEN AQLKERVSSL  120
QIIHADLITP LRIEGDVTVN TNGNQLTAED SSTP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15072KRKLKRMISNRKSARRSRMRKKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr020210.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009348038.21e-111PREDICTED: basic leucine zipper 43-like
TrEMBLA0A498JSG01e-88A0A498JSG0_MALDO; Uncharacterized protein
STRINGXP_009348038.11e-106(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130442430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60830.19e-21basic leucine-zipper 70