PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr020183.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family SBP
Protein Properties Length: 542aa    MW: 59200 Da    PI: 7.9662
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr020183.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.73e-42159234277
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  Cqv gC++dls++k+yh+rhkvCevhsk+++v+++g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  Pbr020183.1 159 CQVYGCNKDLSSCKDYHKRHKVCEVHSKTAKVIINGIEQRFCQQCSRFHLLGEFDDGKRSCRKRLAGHNERRRKPQ 234
                  **************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.5E-33154220IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.351156233IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.22E-39157236IPR004333Transcription factor, SBP-box
PfamPF031104.4E-31159232IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MESWSCISEG KGFVVSDETI SHTDSLSRSR NGLMGWELKI PCTFMESQGF GELGNLGLPE  60
MVGKHLQNDS IRDVVSTSIS TPNLFSGEAE SSSRISSSIV DSSSRDSSLI DLKLGRLADH  120
KGVHSSKLSK GTPMLSSSES STPTKRMRVS GVYSQPAYCQ VYGCNKDLSS CKDYHKRHKV  180
CEVHSKTAKV IINGIEQRFC QQCSRFHLLG EFDDGKRSCR KRLAGHNERR RKPQIGSHSG  240
RAERFPQSFD GGRFEGNMLT TASFICQEIL PSGNLNPEKY GTSDWCRRLK AEGGTHYRPF  300
LGMPVANGHL HSKPVLPSYD IGKQYPPLHE NRTNPQNASI FGQNGSQYPQ DVRGLSSGSH  360
SIFHETALGS QNLNVFDTAS AVQGLLGISD SGCALSLLSS QSQNSSSYFS GIPIARPLVI  420
PASHNFPSSG INSGAGNHLS PIPLSNGCDD TDDFGISDGI FQGSGFVNTK DRLPSQDGAT  480
INLLQLSSHL QRVEDQRQSM LVKQENDAFC FTENHLKSDL QIRTRSVNAC RSWEQIYHGS  540
P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-291592321184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr020183.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009346206.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_018500621.10.0PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLA0A498JRF10.0A0A498JRF1_MALDO; Uncharacterized protein
STRINGXP_009346206.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-46SBP family protein