PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr020017.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family ARR-B
Protein Properties Length: 663aa    MW: 73600.8 Da    PI: 6.5922
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr020017.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.82.4e-28204257155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kpr++W+ eLH++Fv av+qL G++kA+Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Pbr020017.1 204 KPRVVWSVELHRKFVAAVNQL-GIDKAVPKKILDLMNVEKLTRENVASHLQKYRL 257
                  79*******************.********************************8 PP

2Response_reg77.25.8e-26201281109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+p+ ++ll+ +l++ +y +v++++++  al+ll+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++ +g+ +++ + +  Ga 
   Pbr020017.1  20 VLAVDDDPICLKLLEALLRRCQY-HVTTTSQAITALKLLRENKdkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSVNGDHKLVMKGITHGAC 114
                   799********************.***************888888*******************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +e+l +
   Pbr020017.1 115 DYLLKPVRIEQLKN 128
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.9E-1681655IPR017053Response regulator B-type, plant
SuperFamilySSF521722.42E-3417138IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23005.5E-4117152No hitNo description
SMARTSM004481.9E-3018130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.97319134IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.9E-2320128IPR001789Signal transduction response regulator, receiver domain
CDDcd001568.60E-2621134No hitNo description
PROSITE profilePS5129412.269201260IPR017930Myb domain
SuperFamilySSF466897.53E-20201261IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-30202262IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-25204257IPR006447Myb domain, plants
PfamPF002491.2E-6206256IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 663 aa     Download sequence    Send to blast
MTVERVLDEP RDQFPIGMRV LAVDDDPICL KLLEALLRRC QYHVTTTSQA ITALKLLREN  60
KDKFDLVISD VHMPDMDGFK LLELVGLEMD LPVIMLSVNG DHKLVMKGIT HGACDYLLKP  120
VRIEQLKNIW QHVIRKKVDS KDQNSGNQDK SHAGSGEGGL GSVGMGNSDQ NAKLNKKRKD  180
QNEGEDEDHD EDEYENDDPS TQKKPRVVWS VELHRKFVAA VNQLGIDKAV PKKILDLMNV  240
EKLTRENVAS HLQKYRLYLK RISCVANQQA NMVAALGTSD SSYLRTASMN GVGNYHALTG  300
PAQFHNNGYR SFPPNGMIGR LNTPAGVGLH CLPSSGMFQL GHAQNPSNSI NDQPVMFPGN  360
RNGNMLPAHL ELDQQHSRGS TYDAPIYPNS SGFTDGKVTN RSNDPFGLTD DTLLRHTQDS  420
EVGRNHVMLQ SSVSMTSLKP ELSPSFLDHR RLNDNWPTAA QSSAFRSNSF SARDTFKQPT  480
LLVSNLRDDM PIMSSQIGSS QIDVSCINSI SCQSQDSRIG MQIPASTMSN NSGPTINNDL  540
FMGWDEPKQD SPFRPDVMCS SMNNLRPVND NVATFDQNLD ARSSAFQRNS DFNSIGQPNF  600
LDVEISTMDA PLKLKQQGYL MDQRKPQGGY VPHNAGSLDE LVSSMMKQVR SFFTGLSYCQ  660
IH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-26200263164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr020017.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009363889.10.0PREDICTED: two-component response regulator ARR12 isoform X1
SwissprotA2X1N21e-145ORR24_ORYSI; Two-component response regulator ORR24
TrEMBLA0A498HVB00.0A0A498HVB0_MALDO; Two-component response regulator
STRINGXP_009363889.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-131response regulator 12