PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr019035.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family ARR-B
Protein Properties Length: 670aa    MW: 74056.6 Da    PI: 6.5918
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr019035.2genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.82.5e-28204257155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kpr++W+ eLH++Fv av+qL G++kA+Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Pbr019035.2 204 KPRVVWSVELHRKFVAAVNQL-GIDKAVPKKILDLMNVEKLTRENVASHLQKYRL 257
                  79*******************.********************************8 PP

2Response_reg77.25.9e-26201281109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+p+ ++ll+ +l++ +y +v++++++  al+ll+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++ +g+ +++ + +  Ga 
   Pbr019035.2  20 VLAVDDDPICLKLLEALLRRCQY-HVTTTSQAITALKLLRENKdkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSVNGDHKLVMKGITHGAC 114
                   799********************.***************888888*******************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +e+l +
   Pbr019035.2 115 DYLLKPVRIEQLKN 128
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.1E-1662666IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23001.8E-4117169No hitNo description
SuperFamilySSF521721.27E-3417140IPR011006CheY-like superfamily
SMARTSM004481.9E-3018130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.97319134IPR001789Signal transduction response regulator, receiver domain
PfamPF000724.0E-2320128IPR001789Signal transduction response regulator, receiver domain
CDDcd001568.86E-2621134No hitNo description
SuperFamilySSF466897.7E-20201261IPR009057Homeodomain-like
PROSITE profilePS5129412.269201260IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-30202262IPR009057Homeodomain-like
TIGRFAMsTIGR015574.8E-25204257IPR006447Myb domain, plants
PfamPF002491.2E-6206256IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 670 aa     Download sequence    Send to blast
MIVERVLDEP RDQFPIGMRV LAVDDDPICL KLLEALLRRC QYHVTTTSQA ITALKLLREN  60
KDKFDLVISD VHMPDMDGFK LLELVGLEMD LPVIMLSVNG DHKLVMKGIT HGACDYLLKP  120
VRIEQLKNIW QHVIRRKKVD SKDQNSGNQD KSAGCGEGGV GSVGTGNSDQ NAKLNKKRKD  180
QNDGEDEDHD EDEYENDDPS TQKKPRVVWS VELHRKFVAA VNQLGIDKAV PKKILDLMNV  240
EKLTRENVAS HLQKYRLYLK RISCVANQQA NMVAALGTSD SSYLRTASMN GVGNYHTLTG  300
PAQFHNNGYR SFPPGGMIGR LNTPAGVGLH CLPSSGMFQL GHAQNPSNAI NDQPVMFPGN  360
RNGNMLPPHL ELDQQHNRGS TYGAPIYPDS SGFTDAKVMN RSNDPFGLTD NTMLRHTHDS  420
EVGRNHVMQS SVSMPSLKPG LGPPFLDRGR LNDNWSTAAQ PSAFRSNSLS ASDSFKQPTL  480
LVSNLKDDMP VMSSQIGSSQ IIVSSINSIP CQLQDSRIGS QIPASTMNNN SDPTINNDLF  540
LGWDEPKQDS PFQSDVMCSS MNNLMPVNDN VAPSHQNLDT RSSAFQRNSE FNLIGQPNFL  600
DPLLMNYDGV EISTMDAPLK LKQQGYLMDQ RKPQGGYVPH NAGSLDELVS SMIKQVRSFS  660
TGLFYCQIH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-26200263164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr019035.2
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009350850.10.0PREDICTED: two-component response regulator ARR12-like
SwissprotQ6H8051e-148ORR24_ORYSJ; Two-component response regulator ORR24
TrEMBLA0A498J7D60.0A0A498J7D6_MALDO; Two-component response regulator
STRINGXP_009350850.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-127response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]