PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr018814.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family TCP
Protein Properties Length: 327aa    MW: 35289 Da    PI: 5.8655
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr018814.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP102.38.2e-3263122261
          TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaike 61 
                  a+++ +++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d+ ti+WLl+ a+pai+ 
  Pbr018814.1  63 APRRASTKDRHTKVEGRGRRIRMPATCAARIFQLTRELGHKSDGDTIQWLLEHAEPAIIX 122
                  789*******************************************************86 PP

2TCP51.44.2e-161281723479
          TCP  34 dLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec.eaesss 79 
                  +L++eLG+++d+ ti+WLl+ a+pai+++tgt++ +a +     + s
  Pbr018814.1 128 QLTRELGHKSDGDTIQWLLEHAEPAIIAATGTGTVPAIAIsV--NGS 172
                  8*******************************8888844311..111 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036349.6E-2768122IPR005333Transcription factor, TCP
PROSITE profilePS5136925.33769123IPR017887Transcription factor TCP subgroup
PfamPF036346.3E-12128181IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MDMIQEEQQH ERDRDQDEDA SAADLGIDGG GESDPEDPTD PSRALALPPK QEQDVPMTVA  60
VHAPRRASTK DRHTKVEGRG RRIRMPATCA ARIFQLTREL GHKSDGDTIQ WLLEHAEPAI  120
IXXXXXXQLT RELGHKSDGD TIQWLLEHAE PAIIAATGTG TVPAIAISVN GSLKIPTDVR  180
PGDDPPDQKK RKRNSNSEYV DLNDGVSVSA GLAPLTTEGR RQPPPPQPPT TAVQAVAPQG  240
MVPMWAIPSN TVVPGAFFMV PSTTQPHIFT FPTTLPAAPF INISARPISS FVGPSSAAPX  300
XXXXXXXXXX XXPQPLQRAV AAALRR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00635PBMTransfer from PK14653.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr018814.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018507262.11e-175PREDICTED: transcription factor TCP9-like
SwissprotO646475e-72TCP9_ARATH; Transcription factor TCP9
TrEMBLA0A498KHQ51e-170A0A498KHQ5_MALDO; Uncharacterized protein
STRINGXP_009375861.11e-173(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21183086
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.11e-65TCP family protein