PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr016995.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family G2-like
Protein Properties Length: 488aa    MW: 53110.5 Da    PI: 7.4108
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr016995.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.36.4e-32273328156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Pbr016995.1 273 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 328
                  68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.355270330IPR017930Myb domain
SuperFamilySSF466895.73E-17270331IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.4E-28271331IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-26273328IPR006447Myb domain, plants
PfamPF002498.7E-7275326IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MASSPSELSL DYKPHSYSML LKSFGDLQAT HLHDQSQTQK LEEFLSRLEE ERLKIDAFKR  60
ELPLSMQLLT TAVEASRQQL QAYRTNNIQG QNRPVLEEFI PLKHSNSEGS EKPTNATSDK  120
ANWMTSAQLW SQATDHNPNA TSKPQSTITT GPKETDIGFS VSPKLGFENK QHRSYGGGAF  180
LPFSKDRSPT LRPLPELALA SPENNKSEIV LEDKTNHLEN GNINSSSAAG NCNEQGKLLG  240
AGGINNSSEG QNGQTTITAG AGATTTTTQT HRKARRCWSP DLHRRFVNAL QMLGGSQVAT  300
PKQIRELMKV DGLTNDEVKS HLQKYRLHTR RPSPSPQAGG GPTPQLVVLG GIWVQPEYAT  360
AAHNGSAALY SPQPGSQAPP HYCATPMPQD FYTTPQQLHH HTLQHQLHVY RTSTVSHTQS  420
SPESDGRGAG DRSGSIEDGK SESGSWKGTE NGDHVHMNGG DQRNGGLTAR RSEDGEDSNG  480
SQITLKF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-13273326154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-13273326154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-13273326154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-13273326154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr016995.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2950577e-45GU295057.1 Malus x domestica clone Florina BAC 36I17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009374059.10.0PREDICTED: myb family transcription factor EFM-like
SwissprotQ9ZQ851e-122EFM_ARATH; Myb family transcription factor EFM
TrEMBLA0A498HSH20.0A0A498HSH2_MALDO; Uncharacterized protein
STRINGXP_009374059.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54663455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-105G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]