PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr016659.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family G2-like
Protein Properties Length: 375aa    MW: 41432.9 Da    PI: 8.7156
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr016659.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.82.1e-32251304255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  pr+rWt++LH rFv+ave+LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Pbr016659.1 251 PRMRWTSTLHGRFVHAVEHLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 304
                  9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.33E-15248304IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.4E-29249304IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-24251304IPR006447Myb domain, plants
PfamPF002498.7E-7252303IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MPLEGIFIEP STTRTATSSQ IPDLSLHISP PNTTFSNSSS IFNSKTTNEP QNPTTQAHTE  60
LSLGRCFTGG AHEQEPPQNP YQQQSFHLQS SNSHLSHLNH GVSLLDVSSS ERLRPIKGIP  120
VYHQNRSFPF LPMDNINTRD HHKDSKMCFY PRPLPPSFNH PFPSAATHNT QSTPYFGGGG  180
ATGLEPMSRF TGFSSVDAFK SNNQLHHHHH LHHHNQYGIG GIGPISEGSH HGIMRSTFLP  240
KLPTKRSMRA PRMRWTSTLH GRFVHAVEHL GGHERATPKS VLELMNVKDL TLAHVKSHLQ  300
MYRTVKTTDK PAASSGQSDG SGEDDILSPI SSATDHHGLH NTQQFPEQRG PSDQSVRPDV  360
DYTSSTTLWS NSSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-16252306458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-16252306458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-16252306357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16252306357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16252306357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16252306357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-16252306458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-16252306458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-16252306458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-16252306458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-16252306458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-16252306458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr016659.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009370089.10.0PREDICTED: transcription repressor KAN1 isoform X2
TrEMBLA0A498J5350.0A0A498J535_MALDO; Uncharacterized protein
STRINGXP_009370088.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-50G2-like family protein