PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr015983.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family SBP
Protein Properties Length: 420aa    MW: 46765.7 Da    PI: 8.1748
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr015983.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP124.25.5e-39172249178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +CqvegC++ l +akeyhrrhkvC +hska+ v+v g+ qrfCqqCsrfh +sefDe+krsCrrrLa+hnerrrk+++
  Pbr015983.1 172 RCQVEGCHVALLNAKEYHRRHKVCAMHSKASRVTVLGQDQRFCQQCSRFHVVSEFDESKRSCRRRLAGHNERRRKSSH 249
                  6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114131.505170247IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.105.9E-32170234IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-37171252IPR004333Transcription factor, SBP-box
PfamPF031104.0E-30173246IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MDMLSHDVNN FSSREQNGRN NSQLPNSWVI WDTTTTSHTT AAPTNNNNHV LYSTAATAVT  60
VAAIGEEASS STTTGGHALF TGHPLHHQFS NMYSCWADHG GGPHFHQDPH LMCLKLGKRH  120
YFEDHGNHAP PLDERHVAGF PVGMMSKKGK AAAAAAQLYG AGQPLALKVV PRCQVEGCHV  180
ALLNAKEYHR RHKVCAMHSK ASRVTVLGQD QRFCQQCSRF HVVSEFDESK RSCRRRLAGH  240
NERRRKSSHD PLARSSSQDN KLMTGRFQYL SSTTGRALSL LSSKTTLDSW VSPSDLSSRS  300
STALRELIAE NRAANLARQL MSSDRNWDSS SHNNNVTEDL FCDHGQSWSN SVEPHQHQMF  360
PENQHGWDRF HESSGAHLTL DLRRPPSQAY GFMSERAKTK AEEDQECDLW NSFQGTSVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-281732461184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr015983.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009373188.10.0PREDICTED: squamosa promoter-binding-like protein 7 isoform X1
TrEMBLA0A498JCH40.0A0A498JCH4_MALDO; Uncharacterized protein
STRINGXP_009373188.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96132738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.12e-33squamosa promoter binding protein-like 9