PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr015125.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family SBP
Protein Properties Length: 1075aa    MW: 118895 Da    PI: 7.8909
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr015125.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.51.3e-40148225178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cqv++C++dls+ak+yhrrhkvCevhsk++ +lv++++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  Pbr015125.1 148 MCQVDNCKEDLSNAKDYHRRHKVCEVHSKSTRALVAKQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 225
                  6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.1E-34142210IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.966146223IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.62E-37147227IPR004333Transcription factor, SBP-box
PfamPF031103.2E-29149222IPR004333Transcription factor, SBP-box
SuperFamilySSF484038.29E-6856961IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.203.1E-4861971IPR020683Ankyrin repeat-containing domain
CDDcd002048.41E-5869958No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1075 aa     Download sequence    Send to blast
METAGGQVAA PIYIHQTLSG RFCDSPVMGR KRDLPYQGPN YQHPYSQQPR FTNPGNDWNP  60
HVWDWDAVRF VAKPLDSRMM HLGTTSTTEQ RNKEEASGPV KDTAEDEDDE SLQLNLAGGF  120
TSVEEPVPRP NKRVRSGSPG NGNGNYPMCQ VDNCKEDLSN AKDYHRRHKV CEVHSKSTRA  180
LVAKQMQRFC QQCSRFHPLS EFDEGKRSCR RRLAGHNRRR RKTQPEDVTS RLTLPGDGDN  240
KIIGNSDIVN LLAAIARPQG KNDVRNINGS SVLDREQLLQ VLSKINSLPL SADLAAKLPN  300
LGSLTRKASE LLSLDLQNKL NGRASVSTMD LLTVLSATLA TSAPEAYAML SQKCSQSSDS  360
EKTKLTCSDQ AAEPNLHKIP PQEIHSAGGE RSSTSYQSPM EDSDCQIQEA RVNLPLQLFS  420
SSPENDSPPK LASSRKYFSS DSSNPTEDRS PSSSPPVVQT LFPLKSLAET VKSDKLLVSK  480
EGSGNPDNSW TCGSNMPFDL FRGSNRGAEA SSIQNFPNQP GYTSSGSDHS PSSLNSDVQD  540
RTGRILFKLF DKDPSHLPGT LRTQIFNWLS SSPSEMESYI RPGCVVLSVY VSMPSASWEQ  600
LEENLVQRVS SLVQSSDSDF WRSGRFLVNT GRQLASHKDG KTRTCKAWRS CSSPELISVS  660
PLAVVGGQET SLLLRGRNLN NLGTRIHCTY MGGYTSKEAT GSAYRGTTYD EIDLGSFQIH  720
DASPGVLGRC FIEVENGFKG NSFPVIIADA TICRELKVLE SVFDAEAKVC DVISVAGSHD  780
YGRPTSRDEV LHFLNELGWL FQRKRICSML QEPHYALSRF KFLLTFTVEK DFCALVKTLL  840
DILFERNFDS DALSGGLVML SDMQLLNRAV KRRCRKMVDL LINYSTVNSD SDKRYIFPPN  900
LAGPGGMTPL HLAACMSSTD DMIDALTNDP LEIGLNCWKS LLDANGQSPY AYALMRNNYS  960
YNNLVARKLA DRRNSQITVT IGDERDQHQM SMELEHRTST QFRQGSRSCT KCAIAATKYT  1020
RRVPGAQGLL QRPFIHSMLA IAAVCVCVCL FLRGLPDIGL VAPFKWENLG YGTI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-30141222384squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1867872RAVKRR
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr015125.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009372667.10.0PREDICTED: squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A498JSE00.0A0A498JSE0_MALDO; Uncharacterized protein
STRINGXP_009372667.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]