PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr013948.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family HD-ZIP
Protein Properties Length: 809aa    MW: 87883.9 Da    PI: 5.2781
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr013948.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox68.49.4e-22120175156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  ++k +++t++q++eLe++F+++++p++++r eL+++lgL+ +qVk+WFqNrR+++k
  Pbr013948.1 120 KKKYHRHTPNQIQELENFFKECPHPDEKQRSELSRRLGLESKQVKFWFQNRRTQMK 175
                  79999************************************************999 PP

2START1854.1e-583275462205
                  HHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS..........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
        START   2 laeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.........dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                  la++a++elvk++++++p+W kss   +++n +e+        +           +ea r++ vv+ ++  lve+l+d + +W e+++    +a+t++
  Pbr013948.1 327 LALAAMDELVKMVQVDSPLWIKSSdgtDILNIEEYQA------FscigmkpssLVTEATRDTCVVIVNSLALVETLMDAN-RWAEMFQclvaRASTID 417
                  6899********************7665555555433......333345678789*************************.***************** PP

                  EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--S CS
        START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkg 174
                   is+g      galqlm+aelq+lsp+vp R   f+R+++q+ +g+w++vdvS+d +q+ p++ ++v +++lpSg+++++++n+ skvtw+eh+++++
  Pbr013948.1 418 MISNGmdgtrnGALQLMYAELQMLSPMVPvRPLKFLRFCKQHAEGVWAVVDVSIDINQEGPNTNPFVDCRRLPSGCVVQDMPNNCSKVTWIEHTEYDE 515
                  ************************************************************************************************** PP

                  SXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
        START 175 rlphwllrslvksglaegaktwvatlqrqce 205
                  +++h l+r +++sg+ +ga++w+atlqrq+e
  Pbr013948.1 516 NIVHHLFRETLRSGMGFGAQRWLATLQRQGE 546
                  *****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.61E-21103177IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-22107177IPR009057Homeodomain-like
PROSITE profilePS5007117.945117177IPR001356Homeobox domain
SMARTSM003891.0E-18119181IPR001356Homeobox domain
CDDcd000865.12E-20120177No hitNo description
PfamPF000463.0E-19120175IPR001356Homeobox domain
PROSITE patternPS000270152175IPR017970Homeobox, conserved site
PROSITE profilePS5084840.947317550IPR002913START domain
SuperFamilySSF559612.42E-30318547No hitNo description
CDDcd088752.25E-108321546No hitNo description
SMARTSM002341.1E-41326547IPR002913START domain
PfamPF018525.3E-50327546IPR002913START domain
Gene3DG3DSA:3.30.530.206.1E-7380530IPR023393START-like domain
SuperFamilySSF559611.1E-21568802No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 809 aa     Download sequence    Send to blast
MSLGGLISSS GGGNSGGGRG RVVAEIAPHA PSFMPSGTIA HPHFLSSPIP NPMQTSSSAL  60
SLSIQKMDGH SELGFAENFD PGIIGRLRDD EHESKSGSDN FEGASGDDQD GGGGDQPPRK  120
KKYHRHTPNQ IQELENFFKE CPHPDEKQRS ELSRRLGLES KQVKFWFQNR RTQMKTQLER  180
HENIILRQEN DKLIAENGVM KDAISNPVCN NCGGPAIPGQ ISFDEHQLRI ENARLKEELN  240
RICAMANKLP ISSLGITGSI LNATSGLELG VGRNGVDGMN AVSAGLPMGF DLGDGISSFS  300
PMIPPVKTSS GMMGNEVPFE RSMYIDLALA AMDELVKMVQ VDSPLWIKSS DGTDILNIEE  360
YQAFSCIGMK PSSLVTEATR DTCVVIVNSL ALVETLMDAN RWAEMFQCLV ARASTIDMIS  420
NGMDGTRNGA LQLMYAELQM LSPMVPVRPL KFLRFCKQHA EGVWAVVDVS IDINQEGPNT  480
NPFVDCRRLP SGCVVQDMPN NCSKVTWIEH TEYDENIVHH LFRETLRSGM GFGAQRWLAT  540
LQRQGESLAF LISSANSNED LSGIDVSGKK SMLKLAQRMV DNFCAGISAS SVRKWDKLCF  600
ENVSEDVRVM ARKSMNDPGE PPGIVLSVAT TVWVPVSRHR VFEFLRDEQF RKDWDILSSG  660
VPMQRIIQIG KGQEGANGVS LLRANAPNAN NSNMLILQET WTDPTGSLVV YAPVDTESIN  720
VVMRGGDSAY VALLPSGFAI LPGGPPGYEV VKSEGNGYDG SGGCLLTVAF QILVSSLPTA  780
KINMESVETV STLISCTIQR IKSALLAA*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr013948.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009371299.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A498JJE70.0A0A498JJE7_MALDO; Uncharacterized protein
STRINGXP_009371299.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]